Chlorocebus sabaeus (green monkey): 103230365 Help Entry 103230365         CDS       T04361                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04613   Neutrophil extracellular trap formation csab05034   Alcoholism csab05202   Transcriptional misregulation in cancer csab05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103230365  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103230365   09163 Immune disease    05322 Systemic lupus erythematosus     103230365   09165 Substance dependence    05034 Alcoholism     103230365  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csab03036]     103230365   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103230365 Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103230365 Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103230365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103230365 NCBI-ProteinID:  XP_007987233 LinkDB All DBs Position 25:complement(30820522..30838855) Genome browser AA seq 136 aa AA seqDB search MARTKQTAGKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGVLQEASEAYLVGLFEDTNLCAIHAKRVII MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgccggcaaatcgactggtggtaaagcacccaggaagcaa ctggctacaaaggccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggattttaaa acagatctgcgcttccagagcgcagctattggtgttttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaataatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system