KEGG   Chlorocebus sabaeus (green monkey): 103230532
Entry
103230532         CDS       T04361                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01521  EGFR tyrosine kinase inhibitor resistance
csab01522  Endocrine resistance
csab01524  Platinum drug resistance
csab04010  MAPK signaling pathway
csab04012  ErbB signaling pathway
csab04014  Ras signaling pathway
csab04015  Rap1 signaling pathway
csab04022  cGMP-PKG signaling pathway
csab04024  cAMP signaling pathway
csab04062  Chemokine signaling pathway
csab04066  HIF-1 signaling pathway
csab04068  FoxO signaling pathway
csab04071  Sphingolipid signaling pathway
csab04072  Phospholipase D signaling pathway
csab04114  Oocyte meiosis
csab04140  Autophagy - animal
csab04148  Efferocytosis
csab04150  mTOR signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04210  Apoptosis
csab04218  Cellular senescence
csab04261  Adrenergic signaling in cardiomyocytes
csab04270  Vascular smooth muscle contraction
csab04350  TGF-beta signaling pathway
csab04360  Axon guidance
csab04370  VEGF signaling pathway
csab04371  Apelin signaling pathway
csab04380  Osteoclast differentiation
csab04510  Focal adhesion
csab04517  IgSF CAM signaling
csab04520  Adherens junction
csab04540  Gap junction
csab04550  Signaling pathways regulating pluripotency of stem cells
csab04611  Platelet activation
csab04613  Neutrophil extracellular trap formation
csab04620  Toll-like receptor signaling pathway
csab04621  NOD-like receptor signaling pathway
csab04625  C-type lectin receptor signaling pathway
csab04650  Natural killer cell mediated cytotoxicity
csab04657  IL-17 signaling pathway
csab04658  Th1 and Th2 cell differentiation
csab04659  Th17 cell differentiation
csab04660  T cell receptor signaling pathway
csab04662  B cell receptor signaling pathway
csab04664  Fc epsilon RI signaling pathway
csab04666  Fc gamma R-mediated phagocytosis
csab04668  TNF signaling pathway
csab04713  Circadian entrainment
csab04720  Long-term potentiation
csab04722  Neurotrophin signaling pathway
csab04723  Retrograde endocannabinoid signaling
csab04724  Glutamatergic synapse
csab04725  Cholinergic synapse
csab04726  Serotonergic synapse
csab04730  Long-term depression
csab04810  Regulation of actin cytoskeleton
csab04910  Insulin signaling pathway
csab04912  GnRH signaling pathway
csab04914  Progesterone-mediated oocyte maturation
csab04915  Estrogen signaling pathway
csab04916  Melanogenesis
csab04917  Prolactin signaling pathway
csab04919  Thyroid hormone signaling pathway
csab04921  Oxytocin signaling pathway
csab04926  Relaxin signaling pathway
csab04928  Parathyroid hormone synthesis, secretion and action
csab04929  GnRH secretion
csab04930  Type II diabetes mellitus
csab04933  AGE-RAGE signaling pathway in diabetic complications
csab04934  Cushing syndrome
csab04935  Growth hormone synthesis, secretion and action
csab04960  Aldosterone-regulated sodium reabsorption
csab05010  Alzheimer disease
csab05020  Prion disease
csab05022  Pathways of neurodegeneration - multiple diseases
csab05034  Alcoholism
csab05132  Salmonella infection
csab05133  Pertussis
csab05135  Yersinia infection
csab05140  Leishmaniasis
csab05142  Chagas disease
csab05145  Toxoplasmosis
csab05152  Tuberculosis
csab05160  Hepatitis C
csab05161  Hepatitis B
csab05163  Human cytomegalovirus infection
csab05164  Influenza A
csab05165  Human papillomavirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05167  Kaposi sarcoma-associated herpesvirus infection
csab05170  Human immunodeficiency virus 1 infection
csab05171  Coronavirus disease - COVID-19
csab05200  Pathways in cancer
csab05203  Viral carcinogenesis
csab05205  Proteoglycans in cancer
csab05206  MicroRNAs in cancer
csab05207  Chemical carcinogenesis - receptor activation
csab05208  Chemical carcinogenesis - reactive oxygen species
csab05210  Colorectal cancer
csab05211  Renal cell carcinoma
csab05212  Pancreatic cancer
csab05213  Endometrial cancer
csab05214  Glioma
csab05215  Prostate cancer
csab05216  Thyroid cancer
csab05218  Melanoma
csab05219  Bladder cancer
csab05220  Chronic myeloid leukemia
csab05221  Acute myeloid leukemia
csab05223  Non-small cell lung cancer
csab05224  Breast cancer
csab05225  Hepatocellular carcinoma
csab05226  Gastric cancer
csab05230  Central carbon metabolism in cancer
csab05231  Choline metabolism in cancer
csab05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
csab05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103230532 (MAPK3)
   04012 ErbB signaling pathway
    103230532 (MAPK3)
   04014 Ras signaling pathway
    103230532 (MAPK3)
   04015 Rap1 signaling pathway
    103230532 (MAPK3)
   04350 TGF-beta signaling pathway
    103230532 (MAPK3)
   04370 VEGF signaling pathway
    103230532 (MAPK3)
   04371 Apelin signaling pathway
    103230532 (MAPK3)
   04668 TNF signaling pathway
    103230532 (MAPK3)
   04066 HIF-1 signaling pathway
    103230532 (MAPK3)
   04068 FoxO signaling pathway
    103230532 (MAPK3)
   04072 Phospholipase D signaling pathway
    103230532 (MAPK3)
   04071 Sphingolipid signaling pathway
    103230532 (MAPK3)
   04024 cAMP signaling pathway
    103230532 (MAPK3)
   04022 cGMP-PKG signaling pathway
    103230532 (MAPK3)
   04151 PI3K-Akt signaling pathway
    103230532 (MAPK3)
   04150 mTOR signaling pathway
    103230532 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    103230532 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103230532 (MAPK3)
   04148 Efferocytosis
    103230532 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103230532 (MAPK3)
   04210 Apoptosis
    103230532 (MAPK3)
   04218 Cellular senescence
    103230532 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103230532 (MAPK3)
   04520 Adherens junction
    103230532 (MAPK3)
   04540 Gap junction
    103230532 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103230532 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103230532 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103230532 (MAPK3)
   04613 Neutrophil extracellular trap formation
    103230532 (MAPK3)
   04620 Toll-like receptor signaling pathway
    103230532 (MAPK3)
   04621 NOD-like receptor signaling pathway
    103230532 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    103230532 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    103230532 (MAPK3)
   04660 T cell receptor signaling pathway
    103230532 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    103230532 (MAPK3)
   04659 Th17 cell differentiation
    103230532 (MAPK3)
   04657 IL-17 signaling pathway
    103230532 (MAPK3)
   04662 B cell receptor signaling pathway
    103230532 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    103230532 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    103230532 (MAPK3)
   04062 Chemokine signaling pathway
    103230532 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103230532 (MAPK3)
   04929 GnRH secretion
    103230532 (MAPK3)
   04912 GnRH signaling pathway
    103230532 (MAPK3)
   04915 Estrogen signaling pathway
    103230532 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    103230532 (MAPK3)
   04917 Prolactin signaling pathway
    103230532 (MAPK3)
   04921 Oxytocin signaling pathway
    103230532 (MAPK3)
   04926 Relaxin signaling pathway
    103230532 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    103230532 (MAPK3)
   04919 Thyroid hormone signaling pathway
    103230532 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    103230532 (MAPK3)
   04916 Melanogenesis
    103230532 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103230532 (MAPK3)
   04270 Vascular smooth muscle contraction
    103230532 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103230532 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103230532 (MAPK3)
   04725 Cholinergic synapse
    103230532 (MAPK3)
   04726 Serotonergic synapse
    103230532 (MAPK3)
   04720 Long-term potentiation
    103230532 (MAPK3)
   04730 Long-term depression
    103230532 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    103230532 (MAPK3)
   04722 Neurotrophin signaling pathway
    103230532 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    103230532 (MAPK3)
   04380 Osteoclast differentiation
    103230532 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103230532 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103230532 (MAPK3)
   05206 MicroRNAs in cancer
    103230532 (MAPK3)
   05205 Proteoglycans in cancer
    103230532 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    103230532 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    103230532 (MAPK3)
   05203 Viral carcinogenesis
    103230532 (MAPK3)
   05230 Central carbon metabolism in cancer
    103230532 (MAPK3)
   05231 Choline metabolism in cancer
    103230532 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103230532 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103230532 (MAPK3)
   05212 Pancreatic cancer
    103230532 (MAPK3)
   05225 Hepatocellular carcinoma
    103230532 (MAPK3)
   05226 Gastric cancer
    103230532 (MAPK3)
   05214 Glioma
    103230532 (MAPK3)
   05216 Thyroid cancer
    103230532 (MAPK3)
   05221 Acute myeloid leukemia
    103230532 (MAPK3)
   05220 Chronic myeloid leukemia
    103230532 (MAPK3)
   05218 Melanoma
    103230532 (MAPK3)
   05211 Renal cell carcinoma
    103230532 (MAPK3)
   05219 Bladder cancer
    103230532 (MAPK3)
   05215 Prostate cancer
    103230532 (MAPK3)
   05213 Endometrial cancer
    103230532 (MAPK3)
   05224 Breast cancer
    103230532 (MAPK3)
   05223 Non-small cell lung cancer
    103230532 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103230532 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    103230532 (MAPK3)
   05161 Hepatitis B
    103230532 (MAPK3)
   05160 Hepatitis C
    103230532 (MAPK3)
   05171 Coronavirus disease - COVID-19
    103230532 (MAPK3)
   05164 Influenza A
    103230532 (MAPK3)
   05163 Human cytomegalovirus infection
    103230532 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103230532 (MAPK3)
   05165 Human papillomavirus infection
    103230532 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103230532 (MAPK3)
   05135 Yersinia infection
    103230532 (MAPK3)
   05133 Pertussis
    103230532 (MAPK3)
   05152 Tuberculosis
    103230532 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103230532 (MAPK3)
   05140 Leishmaniasis
    103230532 (MAPK3)
   05142 Chagas disease
    103230532 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103230532 (MAPK3)
   05020 Prion disease
    103230532 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    103230532 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    103230532 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103230532 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103230532 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103230532 (MAPK3)
   04934 Cushing syndrome
    103230532 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103230532 (MAPK3)
   01524 Platinum drug resistance
    103230532 (MAPK3)
   01522 Endocrine resistance
    103230532 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csab01001]
    103230532 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csab03036]
    103230532 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csab04147]
    103230532 (MAPK3)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103230532 (MAPK3)
Protein kinases [BR:csab01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103230532 (MAPK3)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103230532 (MAPK3)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103230532 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 103230532
NCBI-ProteinID: XP_007987561
Ensembl: ENSCSAG00000006190
UniProt: A0A0D9R1K1
LinkDB
Position
5:26536471..26545666
AA seq 379 aa
MAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggtggggagccccggagagccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgtgcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctgagcaat
gaccacatctgctacttcctctaccagatcctgcggggcctcaagtacatccactctgct
aatgtgctccaccgggatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgcgatttcggcctggcccggattgctgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacacgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcctttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcctggggcgctagaggccccctaa

DBGET integrated database retrieval system