Chlorocebus sabaeus (green monkey): 103230656 Help Entry 103230656         CDS       T04361                                  Symbol CD247 Name (RefSeq) CD247 molecule   KO K06453   CD3Z antigen, zeta polypeptide Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04650   Natural killer cell mediated cytotoxicity csab04658   Th1 and Th2 cell differentiation csab04659   Th17 cell differentiation csab04660   T cell receptor signaling pathway csab05142   Chagas disease csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     103230656 (CD247)    04660 T cell receptor signaling pathway     103230656 (CD247)    04658 Th1 and Th2 cell differentiation     103230656 (CD247)    04659 Th17 cell differentiation     103230656 (CD247)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103230656 (CD247)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103230656 (CD247)    05169 Epstein-Barr virus infection     103230656 (CD247)   09174 Infectious disease: parasitic    05142 Chagas disease     103230656 (CD247)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103230656 (CD247)    04090 CD molecules [BR:csab04090]     103230656 (CD247) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103230656 (CD247) CD molecules [BR:csab04090]  Proteins   103230656 (CD247) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ITAM TCR_zetazeta Motif Other DBs NCBI-GeneID:  103230656 NCBI-ProteinID:  XP_007987847 Ensembl:  ENSCSAG00000010930 LinkDB All DBs Position 25:61508256..61596464 Genome browser AA seq 166 aa AA seqDB search MKWKELVTAAILQAQFPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD APAYQQGQNQLYKELNLGRREEYDVLDKRRGLDPEMGGKPQRRKNPQEGLYNALQKDKMA EAYSEIGMKGENQRRRGKGHDGLYQGLSTATKDTYDALHMQTLPPR NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaagtggaaggagcttgtcaccgcagccatcctgcaggcacagttcccaattacagag gcacagagctttggcctgctggatcccaaactctgctacctgctggatggaatcctcttc atctatggtgtcattctcactgccctgttcctgagagtgaagttcagcaggagcgcagac gcccccgcgtaccagcagggccagaaccagctctataaggagctcaatctaggacgaaga gaggagtacgatgttttggacaagagacgcggcctggaccctgagatggggggaaagccg cagagaaggaagaaccctcaggaagggctgtacaatgcactgcagaaagataagatggcg gaggcctacagtgagattgggatgaaaggcgagaaccagcgccggaggggcaaggggcac gatggcctttaccaggggctcagtacagccaccaaggatacctacgacgcccttcacatg cagaccctgccccctcgctaa

DBGET integrated database retrieval system