KEGG   Chlorocebus sabaeus (green monkey): 103231401
Entry
103231401         CDS       T04361                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04610  Complement and coagulation cascades
csab04810  Regulation of actin cytoskeleton
csab05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103231401 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    103231401 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103231401 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:csab04515]
    103231401 (ITGAX)
   04090 CD molecules [BR:csab04090]
    103231401 (ITGAX)
Cell adhesion molecules [BR:csab04515]
 Integrins
  Integrin alpha subunits
   103231401 (ITGAX)
CD molecules [BR:csab04090]
 Proteins
  103231401 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 103231401
NCBI-ProteinID: XP_007988951
Ensembl: ENSCSAG00000005672
LinkDB
Position
5:28058172..28087253
AA seq 1194 aa
MLTTFFLPRPPLCPLASSVPWSSSSCNGPRAQSSSSDLLVMTRTRAALLLFAALATSLGF
NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAANQTGGLYQCGYSTGACEPIG
LQVPPEAVNMSLGLSLEATTSPPQLLACGPTVHHGCGRNMYLTGLCFLLAPTQLTRRLPA
SGQECPRQELDIVFLIDGSGSISSDNFATMMNFVRAVINQFQRPSTQFSLMQFSSKFDIH
FTFEKFRRTSNPLDLLASVHQLRGLTHTATAIQKVVRQLFQASHGARGDATKILIVITDG
KKEGDSLDYKDVIPMADAAGIIRYAIGVGSAFQNRNSWKELNDIASKPSQEHIFEVEDFD
ALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPILGAVGSFTWSGGAF
LYPPNMNPTFINMSQENVDMRDSYLGYSTELALWKGVQNLVLGAPRYQHTGKAAIFTQVS
GQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGAPHYYEQTRGGQVSVCPLPRG
WERWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENQGAVYLFHGAL
GPSIGPSHSQRITGSQLSPRLQYFGQALSGGQDLTQDGLVDLAVGARGQALLLRTRPVLW
VRVSMQFKPAEIPRSAFECGEQVVSDQILGQSSICLYIDKRSKKLLGSRDLQSSLTVDLA
LDPGRLSPRATFQETKNRSLSRVQVLGLETYCETFTLLLPTCVEDPVTPITLRLNFTLVG
EPLPAFRNLRPMLAADAQRYFMASLPFEKNCGADHICQDNLGISFSFPGLKTLLVGSNLE
LNAEVMVWNDGEDSYGTTITFSHPAGLSYRHVADGQKQGQLRSLRLTCDSAPAGSQGTWT
TSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTNKTTFQLELPL
KYAVYTVASSHEQSTKYLNFSDSEEKENRVAMHRYQVNNLGQRDLPVSINFWVPVELNQE
AVWMEVEVSHPQNPSLRCSSEKTAPPASDFLAHIQKNPVLDCSIAGCLRFRCDIPSFSVQ
EELDFTLKGNLSFGWVRQTSQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY
KVHNPTPLIVGSSIGGLLLLALITAALYKVGFFKRQYKQMMEEANGQIAPENGT
NT seq 3585 nt   +upstreamnt  +downstreamnt
atgctgacaactttcttcctgccccggccacctctctgcccacttgcctcctcagtaccc
tggtccagctcttcctgcaacggcccaagagctcagagctcctcgtctgaccttctagtc
atgaccaggaccagggcagcgctcctcctgttcgcagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccgcaagagagaacagctgcc
aaccaaacgggcggcctctaccagtgcggctacagcaccggggcctgtgagcccattggc
ctgcaggtccccccggaggccgtgaacatgtccctgggcctgtccctggaggctaccacc
agccccccccagctgctggcctgcggccccacagtgcaccacgggtgtgggaggaacatg
tacctgaccggactctgcttcctcctggcccccacccagctcacccggaggctcccggcg
tccgggcaggagtgcccaagacaggagctggacattgtgttcctgattgatggctcgggc
agcatctcctccgacaactttgccacgatgatgaacttcgtgagagctgtgataaaccag
ttccagagacccagcacccagttttccctgatgcaattctccagtaaattcgacatacac
ttcactttcgagaaattcaggcgcacctcaaaccccctcgacctgttggcttctgttcac
cagctgagagggctcacacacacggccactgccatccaaaaagtcgtgcgccaattgttc
caggcctcacatggggcccgtggggatgccaccaaaattctcattgtcatcactgatggg
aagaaagaaggcgatagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggatcagcttttcaaaacagaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttgaagtggaggactttgat
gctctgaaagatattcaaaaccagctgaaggagaagatctttgccattgaaggtaccgag
accacaagcagtagctccttcgaattggagatggcgcaggagggcttcagtgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggctctctggaaaggggtgcagaacctg
gtcctgggggccccccgctaccagcataccgggaaggctgccatcttcacccaggtgtcc
gggcaatggaggctgaaggccgaagtcacggggacccagattggttcctacttcggggcc
tccctctgctctgtggatgtggatggggatggcagcactgacctgatcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtccgtgtgtcccttgcccaggggg
tgggaaaggtggtggtgtgatgctgttctccacggggagcagggccacccctggggtcgc
tttggggccgctctgacagtgctgggggatgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaagagaaccagggtgctgtctacctgtttcacggagccttg
ggacctagcatcggcccctcccacagccagcggatcaccggctcccagctctcccccagg
ctgcagtattttgggcaggcgctgagcggaggtcaagacctcacccaggatggactggtg
gacctagctgtgggggcccgaggccaagcactcctgctcaggaccagacctgtgctctgg
gtgcgggtgagcatgcagttcaaacctgcggagatccccaggtctgcatttgagtgtggg
gagcaggtggtctctgaccagatcctgggacagtccagcatctgcctttacattgacaaa
cgttccaagaaactgcttgggagccgtgacctccaaagctctctgacggtggacctggct
ctcgaccctggccgcctgagtcctcgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccaagtcctcgggctggagacatactgtgaaaccttcaccctgctgctcccg
acctgcgtggaggaccctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
gagcccctccctgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcatggcctccctcccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcctgaagaccctgctggtggggagtaacctggag
ctgaacgcagaagtgatggtgtggaatgatggggaagactcctacggaaccaccatcacc
ttctcccacccggcaggactgtcctaccgccacgtggcagacggccagaaacaggggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagctgggagccagggcacctggact
accagctgcagaatcaaccacctcatcttccgtggtggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacacccccaggacgaacaagaccaccttccagctggagctcccgctg
aagtatgccgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagaaccgtgtggccatgcacagataccaggttaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatccctgcggtgctcctca
gagaaaactgcacccccagcatctgacttcctggcacacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacatcccctccttcagcgtccag
gaggagctggatttcaccctgaagggcaacctcagttttggctgggtccgccagacatcg
cagaagaaggtgtcggtcgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacgacggtgctggagaagtac
aaggtccacaaccctacgcccctcatcgtaggcagctccattgggggtctgctgctgctg
gcgctcatcacagcagcactgtacaaagttggcttcttcaagcgtcagtacaagcaaatg
atggaggaggcaaatggacaaattgctccagaaaacgggacatag

DBGET integrated database retrieval system