Chlorocebus sabaeus (green monkey): 103233030 Help Entry 103233030         CDS       T04361                                  Name (RefSeq) metallothionein-1E-like   KO K14739   metallothionein 1/2 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04978   Mineral absorption Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     103233030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csab03019]     103233030    03029 Mitochondrial biogenesis [BR:csab03029]     103233030 Messenger RNA biogenesis [BR:csab03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103233030 Mitochondrial biogenesis [BR:csab03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     103233030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  103233030 NCBI-ProteinID:  XP_007991547 LinkDB All DBs Position 5:42540290..42541998 Genome browser AA seq 93 aa AA seqDB search MEQPAAGLQCTFQLPDCVCALPVGAPASPWLEMDPNCSCATGGSCTCAGSCKCKECKCTS CKKSCCSCCPVGCAKCAQGCVCKGVSEKCSCCA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggagcagccggctgcagggctccagtgcactttccaactgcctgactgcgtgtgtgcc ttaccggtgggagctccagcatctccttggctcgaaatggaccccaactgctcctgcgcc actggtggctcctgcacgtgcgccggctcctgcaagtgcaaagagtgcaaatgcacctcc tgcaagaagagctgctgctcctgctgccccgtgggctgtgccaagtgtgcccagggctgt gtctgcaaaggggtgtcggagaagtgtagctgctgtgcctga

DBGET integrated database retrieval system