Chlorocebus sabaeus (green monkey): 103233582 Help Entry 103233582         CDS       T04361                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04010   MAPK signaling pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04020   Calcium signaling pathway csab04151   PI3K-Akt signaling pathway csab04810   Regulation of actin cytoskeleton csab05200   Pathways in cancer csab05207   Chemical carcinogenesis - receptor activation csab05218   Melanoma csab05224   Breast cancer csab05226   Gastric cancer Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103233582 (FGF22)    04014 Ras signaling pathway     103233582 (FGF22)    04015 Rap1 signaling pathway     103233582 (FGF22)    04020 Calcium signaling pathway     103233582 (FGF22)    04151 PI3K-Akt signaling pathway     103233582 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103233582 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103233582 (FGF22)    05207 Chemical carcinogenesis - receptor activation     103233582 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     103233582 (FGF22)    05218 Melanoma     103233582 (FGF22)    05224 Breast cancer     103233582 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103233582 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103233582 (FGF22) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Growth factors (RTK binding)    103233582 (FGF22) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Growth factors/receptors    103233582 (FGF22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  103233582 NCBI-ProteinID:  XP_007992743 Ensembl:  ENSCSAG00000012851 UniProt:  A0A0D9RK79 LinkDB All DBs Position 6:385718..393988 Genome browser AA seq 170 aa AA seqDB search MRRRLWLGLAWLLLARASDAEGAPSAPQRTRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR VQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMDRRGRLYGSRLYTVDCRFRERIE ENGHNTYASQRWHRHGQPMFLALDRRGGPRPGGQTRRYHLSAHFLPVLVS NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgcgccgccgcctgtggctgggcctggcctggctgctgctggcgcgggcgtcggacgcc gagggagccccgagtgcgccgcagagaacgcgcagctacccgcacctggagggcgacgtg cgctggcggcgccttttctcctccactcacttcttcctgcgcgtggaccccggcggccgc gtgcagggcacccgctggcgccacggccaggacagtatcctggagatccgctctgtacac gtgggcgtcgtggtcatcaaagcagtgtcctcaggcttctacgtggccatggaccgccgg ggccgcctctacgggtcgcggctctacactgtggactgcaggttccgggagcgcattgaa gagaacggccacaacacctacgcctcccagcgctggcaccgccacggccagcccatgttc ctggcactggacaggaggggggggccccggccaggcggccagacgcggcggtaccacctg tccgcccacttcctgcccgtcctggtctcctga

DBGET integrated database retrieval system