Chlorocebus sabaeus (green monkey): 103234702 Help Entry 103234702         CDS       T04361                                  Symbol AKT2 Name (RefSeq) AKT serine/threonine kinase 2   KO K04456   RAC serine/threonine-protein kinase [EC:2.7.11.1] Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01521   EGFR tyrosine kinase inhibitor resistance csab01522   Endocrine resistance csab01524   Platinum drug resistance csab04010   MAPK signaling pathway csab04012   ErbB signaling pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04022   cGMP-PKG signaling pathway csab04024   cAMP signaling pathway csab04062   Chemokine signaling pathway csab04066   HIF-1 signaling pathway csab04068   FoxO signaling pathway csab04071   Sphingolipid signaling pathway csab04072   Phospholipase D signaling pathway csab04140   Autophagy - animal csab04150   mTOR signaling pathway csab04151   PI3K-Akt signaling pathway csab04152   AMPK signaling pathway csab04210   Apoptosis csab04211   Longevity regulating pathway csab04213   Longevity regulating pathway - multiple species csab04218   Cellular senescence csab04261   Adrenergic signaling in cardiomyocytes csab04370   VEGF signaling pathway csab04371   Apelin signaling pathway csab04380   Osteoclast differentiation csab04510   Focal adhesion csab04550   Signaling pathways regulating pluripotency of stem cells csab04611   Platelet activation csab04613   Neutrophil extracellular trap formation csab04620   Toll-like receptor signaling pathway csab04625   C-type lectin receptor signaling pathway csab04630   JAK-STAT signaling pathway csab04660   T cell receptor signaling pathway csab04662   B cell receptor signaling pathway csab04664   Fc epsilon RI signaling pathway csab04666   Fc gamma R-mediated phagocytosis csab04668   TNF signaling pathway csab04722   Neurotrophin signaling pathway csab04725   Cholinergic synapse csab04728   Dopaminergic synapse csab04810   Regulation of actin cytoskeleton csab04910   Insulin signaling pathway csab04914   Progesterone-mediated oocyte maturation csab04915   Estrogen signaling pathway csab04917   Prolactin signaling pathway csab04919   Thyroid hormone signaling pathway csab04920   Adipocytokine signaling pathway csab04922   Glucagon signaling pathway csab04923   Regulation of lipolysis in adipocytes csab04926   Relaxin signaling pathway csab04929   GnRH secretion csab04931   Insulin resistance csab04932   Non-alcoholic fatty liver disease csab04933   AGE-RAGE signaling pathway in diabetic complications csab04935   Growth hormone synthesis, secretion and action csab04936   Alcoholic liver disease csab04973   Carbohydrate digestion and absorption csab05010   Alzheimer disease csab05017   Spinocerebellar ataxia csab05132   Salmonella infection csab05135   Yersinia infection csab05142   Chagas disease csab05145   Toxoplasmosis csab05152   Tuberculosis csab05160   Hepatitis C csab05161   Hepatitis B csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05165   Human papillomavirus infection csab05166   Human T-cell leukemia virus 1 infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05168   Herpes simplex virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer csab05205   Proteoglycans in cancer csab05207   Chemical carcinogenesis - receptor activation csab05208   Chemical carcinogenesis - reactive oxygen species csab05210   Colorectal cancer csab05211   Renal cell carcinoma csab05212   Pancreatic cancer csab05213   Endometrial cancer csab05214   Glioma csab05215   Prostate cancer csab05218   Melanoma csab05220   Chronic myeloid leukemia csab05221   Acute myeloid leukemia csab05222   Small cell lung cancer csab05223   Non-small cell lung cancer csab05224   Breast cancer csab05225   Hepatocellular carcinoma csab05226   Gastric cancer csab05230   Central carbon metabolism in cancer csab05231   Choline metabolism in cancer csab05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csab05415   Diabetic cardiomyopathy csab05417   Lipid and atherosclerosis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103234702 (AKT2)    04015 Rap1 signaling pathway     103234702 (AKT2)    04630 JAK-STAT signaling pathway     103234702 (AKT2)    04668 TNF signaling pathway     103234702 (AKT2)    04066 HIF-1 signaling pathway     103234702 (AKT2)    04068 FoxO signaling pathway     103234702 (AKT2)    04072 Phospholipase D signaling pathway     103234702 (AKT2)    04071 Sphingolipid signaling pathway     103234702 (AKT2)    04024 cAMP signaling pathway     103234702 (AKT2)    04022 cGMP-PKG signaling pathway     103234702 (AKT2)    04151 PI3K-Akt signaling pathway     103234702 (AKT2)    04152 AMPK signaling pathway     103234702 (AKT2)    04150 mTOR signaling pathway     103234702 (AKT2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103234702 (AKT2)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103234702 (AKT2)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103234702 (AKT2)    04613 Neutrophil extracellular trap formation     103234702 (AKT2)    04620 Toll-like receptor signaling pathway     103234702 (AKT2)    04660 T cell receptor signaling pathway     103234702 (AKT2)    04662 B cell receptor signaling pathway     103234702 (AKT2)    04664 Fc epsilon RI signaling pathway     103234702 (AKT2)    04666 Fc gamma R-mediated phagocytosis     103234702 (AKT2)    04062 Chemokine signaling pathway     103234702 (AKT2)   09152 Endocrine system    04922 Glucagon signaling pathway     103234702 (AKT2)    04923 Regulation of lipolysis in adipocytes     103234702 (AKT2)    04929 GnRH secretion     103234702 (AKT2)    04915 Estrogen signaling pathway     103234702 (AKT2)    04917 Prolactin signaling pathway     103234702 (AKT2)    04926 Relaxin signaling pathway     103234702 (AKT2)    04935 Growth hormone synthesis, secretion and action     103234702 (AKT2)    04919 Thyroid hormone signaling pathway     103234702 (AKT2)   09154 Digestive system    04973 Carbohydrate digestion and absorption     103234702 (AKT2)   09156 Nervous system    04725 Cholinergic synapse     103234702 (AKT2)    04728 Dopaminergic synapse     103234702 (AKT2)    04722 Neurotrophin signaling pathway     103234702 (AKT2)   09158 Development and regeneration    04380 Osteoclast differentiation     103234702 (AKT2)   09149 Aging    04211 Longevity regulating pathway     103234702 (AKT2)    04213 Longevity regulating pathway - multiple species     103234702 (AKT2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103234702 (AKT2)    05205 Proteoglycans in cancer     103234702 (AKT2)    05207 Chemical carcinogenesis - receptor activation     103234702 (AKT2)    05208 Chemical carcinogenesis - reactive oxygen species     103234702 (AKT2)    05230 Central carbon metabolism in cancer     103234702 (AKT2)    05231 Choline metabolism in cancer     103234702 (AKT2)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103234702 (AKT2)   09162 Cancer: specific types    05210 Colorectal cancer     103234702 (AKT2)    05212 Pancreatic cancer     103234702 (AKT2)    05225 Hepatocellular carcinoma     103234702 (AKT2)    05226 Gastric cancer     103234702 (AKT2)    05214 Glioma     103234702 (AKT2)    05221 Acute myeloid leukemia     103234702 (AKT2)    05220 Chronic myeloid leukemia     103234702 (AKT2)    05218 Melanoma     103234702 (AKT2)    05211 Renal cell carcinoma     103234702 (AKT2)    05215 Prostate cancer     103234702 (AKT2)    05213 Endometrial cancer     103234702 (AKT2)    05224 Breast cancer     103234702 (AKT2)    05222 Small cell lung cancer     103234702 (AKT2)    05223 Non-small cell lung cancer     103234702 (AKT2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103234702 (AKT2)    05170 Human immunodeficiency virus 1 infection     103234702 (AKT2)    05161 Hepatitis B     103234702 (AKT2)    05160 Hepatitis C     103234702 (AKT2)    05164 Influenza A     103234702 (AKT2)    05162 Measles     103234702 (AKT2)    05163 Human cytomegalovirus infection     103234702 (AKT2)    05167 Kaposi sarcoma-associated herpesvirus infection     103234702 (AKT2)    05169 Epstein-Barr virus infection     103234702 (AKT2)    05165 Human papillomavirus infection     103234702 (AKT2)   09171 Infectious disease: bacterial    05135 Yersinia infection     103234702 (AKT2)    05152 Tuberculosis     103234702 (AKT2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103234702 (AKT2)    05142 Chagas disease     103234702 (AKT2)   09164 Neurodegenerative disease    05010 Alzheimer disease     103234702 (AKT2)    05017 Spinocerebellar ataxia     103234702 (AKT2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103234702 (AKT2)    05418 Fluid shear stress and atherosclerosis     103234702 (AKT2)    05415 Diabetic cardiomyopathy     103234702 (AKT2)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103234702 (AKT2)    04932 Non-alcoholic fatty liver disease     103234702 (AKT2)    04931 Insulin resistance     103234702 (AKT2)    04933 AGE-RAGE signaling pathway in diabetic complications     103234702 (AKT2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103234702 (AKT2)    01524 Platinum drug resistance     103234702 (AKT2)    01522 Endocrine resistance     103234702 (AKT2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:csab01001]     103234702 (AKT2) Enzymes [BR:csab01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.1  non-specific serine/threonine protein kinase      103234702 (AKT2) Protein kinases [BR:csab01001]  Serine/threonine kinases: AGC group   AKT/PKB family    103234702 (AKT2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_20 PH_11 ABC1 Seadorna_VP7 Motif Other DBs NCBI-GeneID:  103234702 NCBI-ProteinID:  XP_007995023 Ensembl:  ENSCSAG00000003750 LinkDB All DBs Position 6:complement(34688585..34740458) Genome browser AA seq 481 aa AA seqDB search MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR E NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag acctggaggccacggtacttcctgctgaagagcgacggctccttcattgggtacaaggag aggcccgaggcccctgatcagacccttccccccttaaacaacttctctgtagcagaatgc cagctgatgaagaccgagaggccgcggcccaacaccttcgtcatacgctgcctgcagtgg accacagtcatcgagaggaccttccatgtggattctccagacgagagggaggaatggatg cgggccatccagatggttgccaacagcctcaagcagcgggccccaggtgaggaccccatg gactacaagtgtggctcccccagtgactcctccgcggccgaggagatggaagtggcggtc agcaaggcacgggctaaagtgaccatgaatgatttcgactatctcaaactccttggcaag ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgag agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagatcgtc tcggctcttgagtacttgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac ctcatgctggacaaagacggccacatcaagatcactgactttggcctctgcaaagaaggc atcagtgacggggctaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag gtgctggaggacaatgactatggccgggccgtggactggtgggggctgggtgtggtcatg tacgagatgatgtgcggccgcctgcctttctacaaccaggaccacgagcgcctcttcgag ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg cttgccgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag aagctcctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtactttgat gatgaattcaccgcccagtccatcacaatcacaccccccgaccgctatgacagcctgggc ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgc gagtga

DBGET integrated database retrieval system