Chlorocebus sabaeus (green monkey): 103234920 Help Entry 103234920         CDS       T04361                                  Symbol GNG8 Name (RefSeq) G protein subunit gamma 8   KO K04544   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04014   Ras signaling pathway csab04062   Chemokine signaling pathway csab04081   Hormone signaling csab04082   Neuroactive ligand signaling csab04151   PI3K-Akt signaling pathway csab04371   Apelin signaling pathway csab04713   Circadian entrainment csab04723   Retrograde endocannabinoid signaling csab04724   Glutamatergic synapse csab04725   Cholinergic synapse csab04726   Serotonergic synapse csab04727   GABAergic synapse csab04728   Dopaminergic synapse csab04926   Relaxin signaling pathway csab05032   Morphine addiction csab05034   Alcoholism csab05163   Human cytomegalovirus infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103234920 (GNG8)    04371 Apelin signaling pathway     103234920 (GNG8)    04151 PI3K-Akt signaling pathway     103234920 (GNG8)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     103234920 (GNG8)    04081 Hormone signaling     103234920 (GNG8)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     103234920 (GNG8)   09152 Endocrine system    04926 Relaxin signaling pathway     103234920 (GNG8)   09156 Nervous system    04724 Glutamatergic synapse     103234920 (GNG8)    04727 GABAergic synapse     103234920 (GNG8)    04725 Cholinergic synapse     103234920 (GNG8)    04728 Dopaminergic synapse     103234920 (GNG8)    04726 Serotonergic synapse     103234920 (GNG8)    04723 Retrograde endocannabinoid signaling     103234920 (GNG8)   09159 Environmental adaptation    04713 Circadian entrainment     103234920 (GNG8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103234920 (GNG8)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103234920 (GNG8)    05163 Human cytomegalovirus infection     103234920 (GNG8)    05167 Kaposi sarcoma-associated herpesvirus infection     103234920 (GNG8)   09165 Substance dependence    05032 Morphine addiction     103234920 (GNG8)    05034 Alcoholism     103234920 (GNG8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:csab04031]     103234920 (GNG8) GTP-binding proteins [BR:csab04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     103234920 (GNG8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  103234920 NCBI-ProteinID:  XP_007995495 UniProt:  A0A0D9S2B3 LinkDB All DBs Position 6:complement(39989915..39995714) Genome browser AA seq 106 aa AA seqDB search MAPALSRSRRNPKPHPSGHTPSLNFRASFNPFPAATMSNNMAKIAEARKTVEQLKLEVNI DRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPFRDKRLFCVLL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctcccgccttgtccaggtccagaaggaaccccaagccccatccatcgggacacacc cccagcctcaacttccgcgcgtcttttaaccccttccccgccgcaaccatgtccaacaac atggccaagattgccgaggcccgcaagacggtggaacagctgaagctggaagtgaacatc gaccgcatgaaggtgtcgcaggcagcagcggaactcctggctttctgcgaaacgcatgcc aaagatgacccgctggtgacgccagtacccgccgcggagaaccccttccgcgacaagcgc ctcttttgtgttctgctctga

DBGET integrated database retrieval system