Entry |
|
Symbol |
CXCL8, IL-8
|
Name |
(RefSeq) C-X-C motif chemokine ligand 8
|
KO |
|
Organism |
csab Chlorocebus sabaeus (green monkey)
|
Pathway |
csab04060 | Cytokine-cytokine receptor interaction |
csab04061 | Viral protein interaction with cytokine and cytokine receptor |
csab04620 | Toll-like receptor signaling pathway |
csab04621 | NOD-like receptor signaling pathway |
csab04622 | RIG-I-like receptor signaling pathway |
csab04933 | AGE-RAGE signaling pathway in diabetic complications |
csab05167 | Kaposi sarcoma-associated herpesvirus infection |
csab05202 | Transcriptional misregulation in cancer |
|
Brite |
KEGG Orthology (KO) [BR:csab00001]
09130 Environmental Information Processing
09132 Signal transduction
04064 NF-kappa B signaling pathway
103235786 (CXCL8)
04072 Phospholipase D signaling pathway
103235786 (CXCL8)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
103235786 (CXCL8)
04061 Viral protein interaction with cytokine and cytokine receptor
103235786 (CXCL8)
09140 Cellular Processes
09143 Cell growth and death
04218 Cellular senescence
103235786 (CXCL8)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
103235786 (CXCL8)
04621 NOD-like receptor signaling pathway
103235786 (CXCL8)
04622 RIG-I-like receptor signaling pathway
103235786 (CXCL8)
04657 IL-17 signaling pathway
103235786 (CXCL8)
04062 Chemokine signaling pathway
103235786 (CXCL8)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
103235786 (CXCL8)
05202 Transcriptional misregulation in cancer
103235786 (CXCL8)
09162 Cancer: specific types
05219 Bladder cancer
103235786 (CXCL8)
09172 Infectious disease: viral
05161 Hepatitis B
103235786 (CXCL8)
05171 Coronavirus disease - COVID-19
103235786 (CXCL8)
05164 Influenza A
103235786 (CXCL8)
05163 Human cytomegalovirus infection
103235786 (CXCL8)
05167 Kaposi sarcoma-associated herpesvirus infection
103235786 (CXCL8)
09171 Infectious disease: bacterial
05132 Salmonella infection
103235786 (CXCL8)
05135 Yersinia infection
103235786 (CXCL8)
05133 Pertussis
103235786 (CXCL8)
05134 Legionellosis
103235786 (CXCL8)
09174 Infectious disease: parasitic
05146 Amoebiasis
103235786 (CXCL8)
05144 Malaria
103235786 (CXCL8)
05142 Chagas disease
103235786 (CXCL8)
09163 Immune disease
05323 Rheumatoid arthritis
103235786 (CXCL8)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
103235786 (CXCL8)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
103235786 (CXCL8)
04932 Non-alcoholic fatty liver disease
103235786 (CXCL8)
04933 AGE-RAGE signaling pathway in diabetic complications
103235786 (CXCL8)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:csab04052]
103235786 (CXCL8)
00536 Glycosaminoglycan binding proteins [BR:csab00536]
103235786 (CXCL8)
Cytokines and neuropeptides [BR:csab04052]
Cytokines
Chemokines
103235786 (CXCL8)
Glycosaminoglycan binding proteins [BR:csab00536]
Heparan sulfate / Heparin
Chemokines
103235786 (CXCL8)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
7:22202497..22205730
|
AA seq |
101 aa
MTSKLAVALLAAFLLSAALCEGAVLPRSAKELRCQCIKTYSKPIHPKFIKELRVIESGPH
CVNTEIIVKLSDGRELCLDPKVPWVSRVVEKFLKRAESQNS |
NT seq |
306 nt +upstreamnt +downstreamnt
atgacttccaagctggcggtggctctcttggcagccttcctgctttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacgtac
tccaaacctatccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgtcaatacagaaattattgtaaaactttccgatggaagagagctctgtctggacccc
aaggtaccatgggtgtctagggttgtggagaagtttttgaagagggctgagagtcaaaat
tcataa |