Chlorocebus sabaeus (green monkey): 103235793 Help Entry 103235793         CDS       T04361                                  Name (RefSeq) platelet factor 4   KO K05407   platelet factor 4 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103235793    04061 Viral protein interaction with cytokine and cytokine receptor     103235793  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     103235793  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103235793    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103235793 Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103235793 Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Chemokines    103235793 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CATSPERB_Ig-like Motif Other DBs NCBI-GeneID:  103235793 NCBI-ProteinID:  XP_007997069 LinkDB All DBs Position 7:complement(22464634..22465673) Genome browser AA seq 101 aa AA seqDB search MSSAARFCPSRPVLLFLGLLLLPVLVAFATAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIVKKLLES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagctccgcagcccggttctgcccctcacgccccgtgctgctgtttctggggttgctg ctcctgccagttttggtcgccttcgccacagctgaagctgaagaagatggagacctgcag tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatgggagg aaaatttgcttggacctgcaagccccactgtacaagaaaatagttaagaaacttttggag agttag

DBGET integrated database retrieval system