Chlorocebus sabaeus (green monkey): 103235797 Help Entry 103235797         CDS       T04361                                  Symbol CXCL5 Name (RefSeq) C-X-C motif chemokine ligand 5   KO K05506   C-X-C motif chemokine 5/6 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04657   IL-17 signaling pathway csab04668   TNF signaling pathway csab05133   Pertussis csab05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103235797 (CXCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103235797 (CXCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     103235797 (CXCL5)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     103235797 (CXCL5)    04062 Chemokine signaling pathway     103235797 (CXCL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     103235797 (CXCL5)   09163 Immune disease    05323 Rheumatoid arthritis     103235797 (CXCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103235797 (CXCL5) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103235797 (CXCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Rhomboid Motif Other DBs NCBI-GeneID:  103235797 NCBI-ProteinID:  XP_007997072 Ensembl:  ENSCSAG00000004747 LinkDB All DBs Position 7:complement(22615948..22622840) Genome browser AA seq 113 aa AA seqDB search MSLLSSSAAPVPGASGSLCALLALLLLLTPPGPRSPAGPVAAALRELRCSCLQTTQGVQP EKISNLQVFAIGPQCSEVEVVASLKNGKEVCLDPQAPFLKKVIQKILDGYLSL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagcctcctgtccagcagcgcggcccctgtcccgggtgcttcgggctccttgtgcgcg ctgctggcgctgctgctgctgctgacgccgccagggccccgcagcccagctggtcctgtc gctgctgcgttgagagagctgcgttgcagttgtttacagaccacgcagggagttcaaccc gaaaagatcagtaatctgcaggtgttcgccataggcccgcagtgctctgaggtggaagtg gtagcctccctgaagaacgggaaggaagtttgtcttgatccacaagccccttttctaaag aaagtcatccagaaaattttggacgggtacttgtcactttga

DBGET integrated database retrieval system