Chlorocebus sabaeus (green monkey): 103237820 Help Entry 103237820         CDS       T04361                                  Symbol CALML5 Name (RefSeq) calmodulin like 5   KO K02183   calmodulin Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04020   Calcium signaling pathway csab04022   cGMP-PKG signaling pathway csab04024   cAMP signaling pathway csab04070   Phosphatidylinositol signaling system csab04114   Oocyte meiosis csab04218   Cellular senescence csab04261   Adrenergic signaling in cardiomyocytes csab04270   Vascular smooth muscle contraction csab04371   Apelin signaling pathway csab04625   C-type lectin receptor signaling pathway csab04713   Circadian entrainment csab04720   Long-term potentiation csab04722   Neurotrophin signaling pathway csab04728   Dopaminergic synapse csab04740   Olfactory transduction csab04744   Phototransduction csab04750   Inflammatory mediator regulation of TRP channels csab04910   Insulin signaling pathway csab04912   GnRH signaling pathway csab04915   Estrogen signaling pathway csab04916   Melanogenesis csab04921   Oxytocin signaling pathway csab04922   Glucagon signaling pathway csab04924   Renin secretion csab04925   Aldosterone synthesis and secretion csab04970   Salivary secretion csab04971   Gastric acid secretion csab05010   Alzheimer disease csab05012   Parkinson disease csab05022   Pathways of neurodegeneration - multiple diseases csab05031   Amphetamine addiction csab05034   Alcoholism csab05133   Pertussis csab05152   Tuberculosis csab05163   Human cytomegalovirus infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer csab05214   Glioma csab05417   Lipid and atherosclerosis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103237820 (CALML5)    04015 Rap1 signaling pathway     103237820 (CALML5)    04070 Phosphatidylinositol signaling system     103237820 (CALML5)    04024 cAMP signaling pathway     103237820 (CALML5)    04022 cGMP-PKG signaling pathway     103237820 (CALML5)  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     103237820 (CALML5)    04915 Estrogen signaling pathway     103237820 (CALML5)    04921 Oxytocin signaling pathway     103237820 (CALML5)    04924 Renin secretion     103237820 (CALML5)    04925 Aldosterone synthesis and secretion     103237820 (CALML5)   09154 Digestive system    04970 Salivary secretion     103237820 (CALML5)    04971 Gastric acid secretion     103237820 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     103237820 (CALML5)    04720 Long-term potentiation     103237820 (CALML5)    04722 Neurotrophin signaling pathway     103237820 (CALML5)   09157 Sensory system    04740 Olfactory transduction     103237820 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     103237820 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     103237820 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103237820 (CALML5)   09162 Cancer: specific types    05214 Glioma     103237820 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103237820 (CALML5)    05163 Human cytomegalovirus infection     103237820 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     103237820 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     103237820 (CALML5)    05152 Tuberculosis     103237820 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     103237820 (CALML5)    05012 Parkinson disease     103237820 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     103237820 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     103237820 (CALML5)    05034 Alcoholism     103237820 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103237820 (CALML5)    05418 Fluid shear stress and atherosclerosis     103237820 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csab01009]     103237820 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csab04131]     103237820 (CALML5)    03036 Chromosome and associated proteins [BR:csab03036]     103237820 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103237820 (CALML5) Protein phosphatases and associated proteins [BR:csab01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103237820 (CALML5) Membrane trafficking [BR:csab04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103237820 (CALML5) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103237820 (CALML5) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103237820 (CALML5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EH EF_EFCAB10_C Dockerin_1 SPARC_Ca_bdg DUF5580_M TerB DUF7370 EF-hand_11 Exo70_N MIC5 Motif Other DBs NCBI-GeneID:  103237820 NCBI-ProteinID:  XP_008000342 Ensembl:  ENSCSAG00000019051 UniProt:  A0A0D9SCH4 LinkDB All DBs Position 9:complement(5609208..5610478) Genome browser AA seq 146 aa AA seqDB search MAGELTPEQEAEYKSAFSAIDKNGSGTINAQELGMALQAMGKTVSEAELKKLISQFDSDG DGEISFEEFLAAVKKVRAGREDLQVAFRAFDQDGDGHITVDELKQAMAGLGQPLPQEELD AMIREADVDQDGRVNYEEFARMLTQE NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggccggtgagctgactcctgagcaggaggccgagtacaaaagcgccttctccgcgatt gacaagaatggaagcggcaccatcaatgcccaggaactgggcatggcgctgcaggccatg ggcaagactgtctcggaggccgagctaaagaagctcatctcccagtttgatagcgacggc gacggcgaaatcagcttcgaggagttcttggcggcggtgaagaaggtcagggccggccgg gaggacctgcaggtcgccttccgcgccttcgaccaggacggcgatggccacatcaccgtg gacgagctcaagcaggccatggcggggctggggcagccgctgccgcaggaggagctggat gccatgatccgcgaggccgacgtggaccaggatgggcgggtgaactacgaggagttcgcg aggatgctcacccaggagtga

DBGET integrated database retrieval system