Chlorocebus sabaeus (green monkey): 103239255 Help Entry 103239255         CDS       T04361                                  Symbol DYNLL1 Name (RefSeq) dynein light chain LC8-type 1   KO K10418   dynein light chain LC8-type Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04814   Motor proteins csab04962   Vasopressin-regulated water reabsorption csab05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csab00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103239255 (DYNLL1)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     103239255 (DYNLL1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103239255 (DYNLL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csab03037]     103239255 (DYNLL1)    04812 Cytoskeleton proteins [BR:csab04812]     103239255 (DYNLL1) Cilium and associated proteins [BR:csab03037]  Motile cilia and associated proteins   Dynein arm    103239255 (DYNLL1) Cytoskeleton proteins [BR:csab04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103239255 (DYNLL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  103239255 NCBI-ProteinID:  XP_008003135 Ensembl:  ENSCSAG00000018946 UniProt:  A0A0D9SC74 LinkDB All DBs Position 11:115851020..115855526 Genome browser AA seq 89 aa AA seqDB search MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtgcgaccgaaaggccgtgatcaaaaatgcggacatgtcggaagagatgcaacaggac tcggtggagtgcgctactcaggcgctggagaaatacaacatagagaaggacattgcggct tatatcaagaaggaatttgacaagaagtacaatcccacctggcattgcatcgtgggaagg aacttcggcagttacgtgacacatgaaaccaaacacttcatctacttctacctgggccaa gtggccattcttctgttcaaatctggttaa

DBGET integrated database retrieval system