Chlorocebus sabaeus (green monkey): 103241278 Help Entry 103241278         CDS       T04361                                  Symbol IL1B, IL-1beta Name (RefSeq) interleukin 1 beta   KO K04519   interleukin 1 beta Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01523   Antifolate resistance csab04010   MAPK signaling pathway csab04060   Cytokine-cytokine receptor interaction csab04064   NF-kappa B signaling pathway csab04217   Necroptosis csab04380   Osteoclast differentiation csab04620   Toll-like receptor signaling pathway csab04621   NOD-like receptor signaling pathway csab04623   Cytosolic DNA-sensing pathway csab04625   C-type lectin receptor signaling pathway csab04640   Hematopoietic cell lineage csab04657   IL-17 signaling pathway csab04659   Th17 cell differentiation csab04668   TNF signaling pathway csab04750   Inflammatory mediator regulation of TRP channels csab04932   Non-alcoholic fatty liver disease csab04933   AGE-RAGE signaling pathway in diabetic complications csab04936   Alcoholic liver disease csab04940   Type I diabetes mellitus csab05010   Alzheimer disease csab05020   Prion disease csab05022   Pathways of neurodegeneration - multiple diseases csab05132   Salmonella infection csab05133   Pertussis csab05134   Legionellosis csab05135   Yersinia infection csab05140   Leishmaniasis csab05142   Chagas disease csab05143   African trypanosomiasis csab05144   Malaria csab05146   Amoebiasis csab05152   Tuberculosis csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05168   Herpes simplex virus 1 infection csab05171   Coronavirus disease - COVID-19 csab05321   Inflammatory bowel disease csab05323   Rheumatoid arthritis csab05332   Graft-versus-host disease csab05417   Lipid and atherosclerosis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103241278 (IL1B)    04064 NF-kappa B signaling pathway     103241278 (IL1B)    04668 TNF signaling pathway     103241278 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103241278 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103241278 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103241278 (IL1B)    04620 Toll-like receptor signaling pathway     103241278 (IL1B)    04621 NOD-like receptor signaling pathway     103241278 (IL1B)    04623 Cytosolic DNA-sensing pathway     103241278 (IL1B)    04625 C-type lectin receptor signaling pathway     103241278 (IL1B)    04659 Th17 cell differentiation     103241278 (IL1B)    04657 IL-17 signaling pathway     103241278 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103241278 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     103241278 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     103241278 (IL1B)    05164 Influenza A     103241278 (IL1B)    05162 Measles     103241278 (IL1B)    05168 Herpes simplex virus 1 infection     103241278 (IL1B)    05163 Human cytomegalovirus infection     103241278 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     103241278 (IL1B)    05135 Yersinia infection     103241278 (IL1B)    05133 Pertussis     103241278 (IL1B)    05134 Legionellosis     103241278 (IL1B)    05152 Tuberculosis     103241278 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     103241278 (IL1B)    05144 Malaria     103241278 (IL1B)    05140 Leishmaniasis     103241278 (IL1B)    05142 Chagas disease     103241278 (IL1B)    05143 African trypanosomiasis     103241278 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     103241278 (IL1B)    05321 Inflammatory bowel disease     103241278 (IL1B)    05332 Graft-versus-host disease     103241278 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     103241278 (IL1B)    05020 Prion disease     103241278 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     103241278 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103241278 (IL1B)    05418 Fluid shear stress and atherosclerosis     103241278 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103241278 (IL1B)    04936 Alcoholic liver disease     103241278 (IL1B)    04932 Non-alcoholic fatty liver disease     103241278 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     103241278 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103241278 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103241278 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103241278 (IL1B) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Interleukins    103241278 (IL1B) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Cytokines    103241278 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  103241278 NCBI-ProteinID:  XP_008006600 Ensembl:  ENSCSAG00000016756 LinkDB All DBs Position 14:complement(15844628..15852652) Genome browser AA seq 268 aa AA seqDB search MAEVPELTSEMMAYYSGNEDDLFFEVDGPKQMKCSFQDLDLCPLDGGIQLQISHEHYNKG FRQAVSVVVAMEKLRKMLVPCPQTFQDNDLSTLIPFIFEEEPIFLDTSNNDACVHDAPVR SLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKVPVALGLKA KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTRGGQDITDFTMQFVS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtacctgaactcaccagtgaaatgatggcttactacagtggcaacgaggat gacttgttctttgaagtcgatggccctaaacagatgaagtgctccttccaggatctagac ctctgccctctggatggtggcatccagctacaaatctcccacgagcactacaacaagggc ttccggcaggccgtgtcggttgttgtagccatggagaagctaaggaagatgctggttccc tgcccacagaccttccaggacaatgacctgagcaccttgattcccttcatctttgaagaa gaacctatcttcctcgacacaagcaataacgacgcttgtgtgcatgatgcacctgtacga tcactgcactgcacactccgggatgcacagctaaaaagcttggtgatgtctggtccatat gaactgaaagctctccacctccagggacaggatctggagcaacaagtggtgttctccatg tcctttgtacaaggagaagaaagtaatgacaaagtacctgtggccttgggcctcaaggca aagaacctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata gaaatcaataacaagctggaatttgagtctgcccaattccccaactggtacatcagcacc tctcaagcagaaaacatgcccgtcttcctgggagggaccagaggaggccaggatataact gacttcaccatgcaatttgtgtcttga

DBGET integrated database retrieval system