Chlorocebus sabaeus (green monkey): 103241355 Help Entry 103241355         CDS       T04361                                  Symbol FABP1 Name (RefSeq) fatty acid binding protein 1   KO K08750   fatty acid-binding protein 1, liver Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab03320   PPAR signaling pathway csab04936   Alcoholic liver disease csab04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     103241355 (FABP1)   09154 Digestive system    04975 Fat digestion and absorption     103241355 (FABP1)  09160 Human Diseases   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103241355 (FABP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lipocalin_7 Polysacc_deac_3 AroM RecJ_OB SidE_PDE Motif Other DBs NCBI-GeneID:  103241355 NCBI-ProteinID:  XP_008006679 Ensembl:  ENSCSAG00000016380 UniProt:  A0A0D9RV05 LinkDB All DBs Position 14:18660058..18666730 Genome browser AA seq 127 aa AA seqDB search MSFSGKYQLQSQENFEAFMKAMGLPEELIQKGKDIKSVTEIVQNGKHFKFTITTGSKVIQ NEFTVGEESELETMSGEKVKTVVQLEGNNKLVTTLKNIKSVTELNGDIITSTMTLGDVVF KRISKRI NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgagtttctccggcaagtaccaactgcagagccaggaaaactttgaagccttcatgaag gcaatgggtttgccggaagagctcatccagaaggggaaggatatcaagagtgtgacggaa atcgtgcagaacgggaagcacttcaagttcaccatcaccaccgggtccaaagtgatccaa aacgagttcaccgtgggagaggaaagtgagctggagacaatgtcaggggagaaagtcaag acagtggttcagttggaaggtaacaataaactggtgacaactttgaaaaacatcaagtct gtgaccgaactcaacggcgacataatcaccagtaccatgacattgggcgacgttgtcttc aagagaatcagcaagagaatttaa

DBGET integrated database retrieval system