Chlorocebus sabaeus (green monkey): 103242447 Help Entry 103242447         CDS       T04361                                  Symbol UBB Name (RefSeq) ubiquitin B   KO K04551   ubiquitin B Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04120   Ubiquitin mediated proteolysis csab04137   Mitophagy - animal csab04140   Autophagy - animal csab05012   Parkinson disease csab05022   Pathways of neurodegeneration - multiple diseases csab05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103242447 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103242447 (UBB)    04137 Mitophagy - animal     103242447 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     103242447 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     103242447 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     103242447 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csab04121]     103242447 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103242447 (UBB) Ubiquitin system [BR:csab04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    103242447 (UBB) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of breast milk    103242447 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    103242447 (UBB)   Exosomal proteins of colorectal cancer cells    103242447 (UBB)   Exosomal proteins of bladder cancer cells    103242447 (UBB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N Sde2_N_Ubi HATPase_c Motif Other DBs NCBI-GeneID:  103242447 NCBI-ProteinID:  XP_008008661 UniProt:  A0A0D9R8X7 LinkDB All DBs Position 16:complement(15279271..15289111) Genome browser AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgaccggcaagaccatcacccttgaggtggagcccagt gacaccatcgaaaatgtgaaggccaaaatccaggataaggaaggcattccccccgaccag cagaggcttatctttgcaggcaagcagctggaagatggccgcactctttctgactacaac atccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgaa aatgtgaaggccaagatccaggataaagaaggcatcccccctgaccagcagaggctcatc tttgcgggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggag tcgaccctgcacctggtcctgcgcctgaggggtggctgttaa

DBGET integrated database retrieval system