Chlorocebus sabaeus (green monkey): 103242710 Help Entry 103242710         CDS       T04361                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04621   NOD-like receptor signaling pathway csab04657   IL-17 signaling pathway csab04668   TNF signaling pathway csab04933   AGE-RAGE signaling pathway in diabetic complications csab05135   Yersinia infection csab05142   Chagas disease csab05144   Malaria csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05168   Herpes simplex virus 1 infection csab05171   Coronavirus disease - COVID-19 csab05323   Rheumatoid arthritis csab05417   Lipid and atherosclerosis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103242710   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103242710    04061 Viral protein interaction with cytokine and cytokine receptor     103242710  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103242710    04657 IL-17 signaling pathway     103242710    04062 Chemokine signaling pathway     103242710  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     103242710    05164 Influenza A     103242710    05168 Herpes simplex virus 1 infection     103242710    05163 Human cytomegalovirus infection     103242710   09171 Infectious disease: bacterial    05135 Yersinia infection     103242710   09174 Infectious disease: parasitic    05144 Malaria     103242710    05142 Chagas disease     103242710   09163 Immune disease    05323 Rheumatoid arthritis     103242710   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103242710    05418 Fluid shear stress and atherosclerosis     103242710   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103242710  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103242710    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103242710 Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103242710 Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Chemokines    103242710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 GPR15L CXCL16 Motif Other DBs NCBI-GeneID:  103242710 NCBI-ProteinID:  XP_008009200 UniProt:  A0A0D9R210 LinkDB All DBs Position 16:27763354..27765437 Genome browser AA seq 185 aa AA seqDB search MEKVSRPDPLLPFPTSWKSPGRCICSADLTAHLLFMEDPSSCLTPPSLSLCLFSIKGRDS SQRNREAETNPETSSSQTEACTLTSSMKVSAALLCLLLIAATFSPQGLAQPDAINAPVTC CYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQI QTPKP NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggaaaaagtgtctcgtcctgacccactgcttccctttcctacttcctggaaatcccca ggacgctgcatttgctcagcagatttaacagcccacttattattcatggaagatccctcc tcctgcttgactccaccctctctctccctctgcctgttttcaataaaaggcagagacagc agccagaggaacagagaggctgagactaacccagaaacatccagttctcaaactgaagct tgcaccctcacctccagcatgaaagtctctgcagcacttctgtgcctgctgctcatagca gccaccttcagcccgcaggggctcgctcagccagatgcaatcaatgcccccgtcacttgc tgctataacttcaccaataggaagatctcagtgcagaggctggcgagctatagaagaatc accagcagcaagtgtcccaaagaagctgtgatcttcaagaccattgtggccaaggagatc tgtgctgaccccaagcagaagtgggttcaggattccatggaccacctggacaagcaaatc caaactccaaagccttga

DBGET integrated database retrieval system