Chlorocebus sabaeus (green monkey): 103242711 Help Entry 103242711         CDS       T04361                                  Symbol CCL7 Name (RefSeq) C-C motif chemokine ligand 7   KO K05509   C-C motif chemokine 7 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103242711 (CCL7)    04061 Viral protein interaction with cytokine and cytokine receptor     103242711 (CCL7)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     103242711 (CCL7)    04062 Chemokine signaling pathway     103242711 (CCL7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103242711 (CCL7) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103242711 (CCL7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Trissin Motif Other DBs NCBI-GeneID:  103242711 NCBI-ProteinID:  XP_008009201 LinkDB All DBs Position 16:27777795..27780413 Genome browser AA seq 88 aa AA seqDB search MGKPMPSPSNMKTSAAPLYLLLAAAAFSPQGLAQPDGINTSTTCCYRFINKKIPKQRLES YRRTTSSHCPREAVTCVDDDHPPLTPQS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggggaagcccatgccctcaccctccaacatgaaaacctctgcagcacctctgtatctg ctgctcgcagcagctgccttcagcccccagggtctcgctcagccagatgggattaatact tcaactacctgctgctacagatttatcaataagaaaatcccgaagcagaggctggagagc tacagaaggaccaccagcagccactgtccccgggaagctgtaacatgtgtggatgatgac cacccacccctcacacctcagtcctag

DBGET integrated database retrieval system