Chlorocebus sabaeus (green monkey): 103242750 Help Entry 103242750         CDS       T04361                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine ligand 5   KO K12499   C-C motif chemokine 5 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04620   Toll-like receptor signaling pathway csab04621   NOD-like receptor signaling pathway csab04623   Cytosolic DNA-sensing pathway csab04668   TNF signaling pathway csab05020   Prion disease csab05142   Chagas disease csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05168   Herpes simplex virus 1 infection csab05323   Rheumatoid arthritis csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103242750 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103242750 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     103242750 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103242750 (CCL5)    04621 NOD-like receptor signaling pathway     103242750 (CCL5)    04623 Cytosolic DNA-sensing pathway     103242750 (CCL5)    04062 Chemokine signaling pathway     103242750 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103242750 (CCL5)    05168 Herpes simplex virus 1 infection     103242750 (CCL5)    05163 Human cytomegalovirus infection     103242750 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     103242750 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     103242750 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     103242750 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103242750 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103242750 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103242750 (CCL5) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103242750 (CCL5) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Chemokines    103242750 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103242750 NCBI-ProteinID:  XP_008009272 LinkDB All DBs Position 16:complement(29351214..29361317) Genome browser AA seq 193 aa AA seqDB search MSAEKGFHHWCLVKGETDELTLDERAVRGRQRLEFPEAISVFFSVMCNFTYDTGQCLVAI LETPLRGYPLTGPIKSQPELQRIPAEDPVTARGPPTASPTGTMKVSVAALAVILVATALC TPASASPYASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEK KWVREYINSLEMS NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgtcagcagagaaaggtttccaccactggtgcttggtcaaaggggaaactgatgagctc actctagatgagagggcagtgagggggagacagagactcgaatttccggaggctatttca gttttcttttccgttatgtgcaatttcacttatgataccggccaatgcttggttgctatt ttggaaactccccttagggggtaccccttaactggccctataaagagccagcctgagctg cagaggattcctgcagaggatcctgtgacagcacgtggacctcccacagcctctcccaca ggtaccatgaaggtctccgtggctgccctcgctgtcatcctcgttgctacagccctctgc actcctgcatctgcctccccatatgcctcagacaccacaccctgctgctttgcctacatt gcccgcccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctcc aacccagcagttgtctttgtcacccgaaagaatcgccaagtgtgtgccaacccagagaag aaatgggttcgggagtatatcaactctttggagatgagctag

DBGET integrated database retrieval system