Chlorocebus sabaeus (green monkey): 103242767 Help Entry 103242767         CDS       T04361                                  Symbol CCL3 Name (RefSeq) C-C motif chemokine ligand 3   KO K05408   C-C motif chemokine 3 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04620   Toll-like receptor signaling pathway csab05142   Chagas disease csab05163   Human cytomegalovirus infection csab05323   Rheumatoid arthritis csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103242767 (CCL3)    04061 Viral protein interaction with cytokine and cytokine receptor     103242767 (CCL3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103242767 (CCL3)    04062 Chemokine signaling pathway     103242767 (CCL3)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103242767 (CCL3)   09174 Infectious disease: parasitic    05142 Chagas disease     103242767 (CCL3)   09163 Immune disease    05323 Rheumatoid arthritis     103242767 (CCL3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103242767 (CCL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103242767 (CCL3)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103242767 (CCL3) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103242767 (CCL3) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Chemokines    103242767 (CCL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103242767 NCBI-ProteinID:  XP_008009301 Ensembl:  ENSCSAG00000006128 UniProt:  A0A0D9R1D9 LinkDB All DBs Position 16:29887799..29897664 Genome browser AA seq 92 aa AA seqDB search MQVSTAALAVLLCTAVLCNQISATFAADTPTSCCFSYISRQIPQNFVADYFETSSQCSKP GVIFLTKRGRQVCADPSKEWVQKYVSDLELSA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcaggtctccactgctgcccttgctgtcctcctctgcaccgcggttctctgcaaccag atctcggcaacatttgctgctgacaccccgacctcctgctgcttcagctacatctcccgg cagattccacagaatttcgtagctgactactttgagaccagcagccagtgctctaagccc ggtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtaaggagtgg gtccagaaatacgtcagcgacctggagctgagtgcctga

DBGET integrated database retrieval system