Chlorocebus sabaeus (green monkey): 103242859 Help Entry 103242859         CDS       T04361                                  Symbol DYNLL2 Name (RefSeq) dynein light chain LC8-type 2   KO K10418   dynein light chain LC8-type Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04145   Phagocytosis csab04517   IgSF CAM signaling csab04814   Motor proteins csab04962   Vasopressin-regulated water reabsorption csab05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103242859 (DYNLL2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     103242859 (DYNLL2)   09142 Cell motility    04814 Motor proteins     103242859 (DYNLL2)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     103242859 (DYNLL2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103242859 (DYNLL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csab03037]     103242859 (DYNLL2)    04812 Cytoskeleton proteins [BR:csab04812]     103242859 (DYNLL2) Cilium and associated proteins [BR:csab03037]  Motile cilia and associated proteins   Dynein arm    103242859 (DYNLL2) Cytoskeleton proteins [BR:csab04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103242859 (DYNLL2) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  103242859 NCBI-ProteinID:  XP_008009526 Ensembl:  ENSCSAG00000005643 UniProt:  A0A0D9R015 LinkDB All DBs Position 16 Genome browser AA seq 89 aa AA seqDB search MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccggaaggcagtgatcaagaacgcagacatgtctgaggacatgcaacaggat gccgttgactgtgccacgcaggccatggagaagtacaatatagagaaggacattgctgcc tatatcaagaaggaatttgacaagaaatataaccctacctggcattgtatcgtgggccga aattttggcagctacgtcacacacgagacaaagcacttcatctatttttacttgggtcaa gttgcaatcctcctcttcaagtcaggctag

DBGET integrated database retrieval system