Chlorocebus sabaeus (green monkey): 103242994 Help Entry 103242994         CDS       T04361                                  Symbol PRCD Name (RefSeq) photoreceptor disc component   KO K19637   progressive rod-cone degeneration protein Organism csab  Chlorocebus sabaeus (green monkey) Brite KEGG Orthology (KO) [BR:csab00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csab03037]     103242994 (PRCD) Cilium and associated proteins [BR:csab03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    103242994 (PRCD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod_cone_degen Motif Other DBs NCBI-GeneID:  103242994 NCBI-ProteinID:  XP_008009842 Ensembl:  ENSCSAG00000005085 LinkDB All DBs Position 16:complement(45124623..45156887) Genome browser AA seq 76 aa AA seqDB search MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSVDADPQSSGSSGPGSSPSPGGC CGSRSSSKRENGGKQH NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtgcaccacccttttcctgctcagcaccctggccatgctctggcgccgccgatttgcc aaccgagtccaaccagagcccagcgacgtggatggggcagctaggggcagcagcgtggac gcagaccctcagtcctcaggcagctcaggtcctggttcgtcccctagcccaggaggatgc tgtgggagccggagcagcagcaagagggagaatggggggaagcagcactag

DBGET integrated database retrieval system