Chlorocebus sabaeus (green monkey): 103244369 Help Entry 103244369         CDS       T04361                                  Symbol ATG12 Name (RefSeq) autophagy related 12   KO K08336   ubiquitin-like protein ATG12 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04068   FoxO signaling pathway csab04136   Autophagy - other csab04140   Autophagy - animal csab04621   NOD-like receptor signaling pathway csab04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     103244369 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103244369 (ATG12)    04136 Autophagy - other     103244369 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csab04131]     103244369 (ATG12)    04121 Ubiquitin system [BR:csab04121]     103244369 (ATG12)    03029 Mitochondrial biogenesis [BR:csab03029]     103244369 (ATG12) Membrane trafficking [BR:csab04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     103244369 (ATG12) Ubiquitin system [BR:csab04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    103244369 (ATG12) Mitochondrial biogenesis [BR:csab03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     103244369 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  103244369 NCBI-ProteinID:  XP_008012377 Ensembl:  ENSCSAG00000014836 UniProt:  A0A0D9RQQ4 LinkDB All DBs Position 23:complement(19073545..19087603) Genome browser AA seq 140 aa AA seqDB search MAEEPQSLLQLPPSSAAGGEGLTEVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcggaggagccgcagtccttgttgcagcttcctccctcaagtgctgctggaggggaa ggacttacggaggtctccccagaaacaaccaccccggagcccccgtcttccgctgcagtt tccccgggaacagaggaacctgctggcgacaccaagaaaaaaattgacattttgctaaag gctgtgggagatactcctattatgaaaacaaagaagtgggcggtagagcgaactcgaacc atccaaggactcattgacttcatcaaaaagtttcttaaacttgtggcctcagaacagttg tttatttatgtgaatcaatcctttgctccttccccagaccaagaagttggaactctgtat gagtgttttggcagtgatggtaaactggttttacattactgcaagtctcaggcatgggga tga

DBGET integrated database retrieval system