Chlorocebus sabaeus (green monkey): 103244968 Help Entry 103244968         CDS       T04361                                  Symbol FGF18 Name (RefSeq) fibroblast growth factor 18   KO K04358   fibroblast growth factor Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04010   MAPK signaling pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04020   Calcium signaling pathway csab04151   PI3K-Akt signaling pathway csab04810   Regulation of actin cytoskeleton csab05200   Pathways in cancer csab05207   Chemical carcinogenesis - receptor activation csab05218   Melanoma csab05224   Breast cancer csab05226   Gastric cancer Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103244968 (FGF18)    04014 Ras signaling pathway     103244968 (FGF18)    04015 Rap1 signaling pathway     103244968 (FGF18)    04020 Calcium signaling pathway     103244968 (FGF18)    04151 PI3K-Akt signaling pathway     103244968 (FGF18)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103244968 (FGF18)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103244968 (FGF18)    05207 Chemical carcinogenesis - receptor activation     103244968 (FGF18)   09162 Cancer: specific types    05226 Gastric cancer     103244968 (FGF18)    05218 Melanoma     103244968 (FGF18)    05224 Breast cancer     103244968 (FGF18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103244968 (FGF18)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103244968 (FGF18) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Growth factors (RTK binding)    103244968 (FGF18) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Growth factors/receptors    103244968 (FGF18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  103244968 NCBI-ProteinID:  XP_008013480 Ensembl:  ENSCSAG00000009667 UniProt:  A0A0D9RBC7 LinkDB All DBs Position 23:73584223..73620881 Genome browser AA seq 207 aa AA seqDB search MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK GQPELQKPFKYTTVTKRSRRIRPTHPA NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc caggtacaggtgctggttgccgaggagaacgtggacttccgcatccacgtggagaaccag acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg accagtgggaaacacatccaggtcctgggccgcaggatcagtgcccgcggcgaggatggg gacaagtatgcccagctcctagtggagacagacaccttcggtagtcaagtccggatcaag ggcaaggagacggaattctacctgtgcatgaaccgcaaaggcaagctggtggggaagccc gatggcaccagcaaggagtgtgtgttcatcgagaaggttctggagaacaactacacggcc ctgatgtcggcgaagtactccggctggtacgtgggcttcaccaagaaggggcggccacgg aagggtcccaagacccgggagaaccagcaggacgtgcatttcatgaagcgctaccccaag gggcagccggagcttcagaagcccttcaagtacacgacggtgaccaagaggtcccgtcgg atccggcccacacaccccgcctag

DBGET integrated database retrieval system