Chlorocebus sabaeus (green monkey): 103245424 Help Entry 103245424         CDS       T04361                                  Symbol CALML4 Name (RefSeq) calmodulin like 4   KO K02183   calmodulin Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04020   Calcium signaling pathway csab04022   cGMP-PKG signaling pathway csab04024   cAMP signaling pathway csab04070   Phosphatidylinositol signaling system csab04114   Oocyte meiosis csab04218   Cellular senescence csab04261   Adrenergic signaling in cardiomyocytes csab04270   Vascular smooth muscle contraction csab04371   Apelin signaling pathway csab04625   C-type lectin receptor signaling pathway csab04713   Circadian entrainment csab04720   Long-term potentiation csab04722   Neurotrophin signaling pathway csab04728   Dopaminergic synapse csab04740   Olfactory transduction csab04744   Phototransduction csab04750   Inflammatory mediator regulation of TRP channels csab04910   Insulin signaling pathway csab04912   GnRH signaling pathway csab04915   Estrogen signaling pathway csab04916   Melanogenesis csab04921   Oxytocin signaling pathway csab04922   Glucagon signaling pathway csab04924   Renin secretion csab04925   Aldosterone synthesis and secretion csab04970   Salivary secretion csab04971   Gastric acid secretion csab05010   Alzheimer disease csab05012   Parkinson disease csab05022   Pathways of neurodegeneration - multiple diseases csab05031   Amphetamine addiction csab05034   Alcoholism csab05133   Pertussis csab05152   Tuberculosis csab05163   Human cytomegalovirus infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer csab05214   Glioma csab05417   Lipid and atherosclerosis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103245424 (CALML4)    04015 Rap1 signaling pathway     103245424 (CALML4)    04371 Apelin signaling pathway     103245424 (CALML4)    04020 Calcium signaling pathway     103245424 (CALML4)    04070 Phosphatidylinositol signaling system     103245424 (CALML4)    04024 cAMP signaling pathway     103245424 (CALML4)    04022 cGMP-PKG signaling pathway     103245424 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103245424 (CALML4)    04218 Cellular senescence     103245424 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103245424 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     103245424 (CALML4)    04922 Glucagon signaling pathway     103245424 (CALML4)    04912 GnRH signaling pathway     103245424 (CALML4)    04915 Estrogen signaling pathway     103245424 (CALML4)    04921 Oxytocin signaling pathway     103245424 (CALML4)    04916 Melanogenesis     103245424 (CALML4)    04924 Renin secretion     103245424 (CALML4)    04925 Aldosterone synthesis and secretion     103245424 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103245424 (CALML4)    04270 Vascular smooth muscle contraction     103245424 (CALML4)   09154 Digestive system    04970 Salivary secretion     103245424 (CALML4)    04971 Gastric acid secretion     103245424 (CALML4)   09156 Nervous system    04728 Dopaminergic synapse     103245424 (CALML4)    04720 Long-term potentiation     103245424 (CALML4)    04722 Neurotrophin signaling pathway     103245424 (CALML4)   09157 Sensory system    04744 Phototransduction     103245424 (CALML4)    04740 Olfactory transduction     103245424 (CALML4)    04750 Inflammatory mediator regulation of TRP channels     103245424 (CALML4)   09159 Environmental adaptation    04713 Circadian entrainment     103245424 (CALML4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103245424 (CALML4)   09162 Cancer: specific types    05214 Glioma     103245424 (CALML4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103245424 (CALML4)    05163 Human cytomegalovirus infection     103245424 (CALML4)    05167 Kaposi sarcoma-associated herpesvirus infection     103245424 (CALML4)   09171 Infectious disease: bacterial    05133 Pertussis     103245424 (CALML4)    05152 Tuberculosis     103245424 (CALML4)   09164 Neurodegenerative disease    05010 Alzheimer disease     103245424 (CALML4)    05012 Parkinson disease     103245424 (CALML4)    05022 Pathways of neurodegeneration - multiple diseases     103245424 (CALML4)   09165 Substance dependence    05031 Amphetamine addiction     103245424 (CALML4)    05034 Alcoholism     103245424 (CALML4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103245424 (CALML4)    05418 Fluid shear stress and atherosclerosis     103245424 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csab01009]     103245424 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csab04131]     103245424 (CALML4)    03036 Chromosome and associated proteins [BR:csab03036]     103245424 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103245424 (CALML4) Protein phosphatases and associated proteins [BR:csab01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103245424 (CALML4) Membrane trafficking [BR:csab04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103245424 (CALML4) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103245424 (CALML4) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103245424 (CALML4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_9 AIF-1 EH GPHH EF-hand_11 Motif Other DBs NCBI-GeneID:  103245424 NCBI-ProteinID:  XP_008014309 LinkDB All DBs Position 26:15278349..15291934 Genome browser AA seq 153 aa AA seqDB search MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDG NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASDLRSKLTSLGEKLTHK EVDDLFREAGIEPNGKVKYDEFIHKITLPGQDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagtttctttcccaagaccaaattaatgagtacaaggaatgcttctccctgtat gacaagcagcagagggggaagataaaagccacagacctcatggtggccatgaggtgcctg ggggccagcccgacgccaggggaggtgcagcggcacctgcagacccacgggatagatgga aatggagagctggatttctccacttttctgaccattatgcacatgcaaataaaacaagaa gacccaaagaaagaaattcttctagccatgttgatggcggacaaggagaagaaaggttac atcatggcgtccgacctgcggtcaaaacttacgagcctgggggagaagctcacccacaag gaagtggatgatcttttcagggaagcaggtatcgaacccaacggcaaagtgaagtatgat gaatttatccacaagatcacccttcctggacaggactattga

DBGET integrated database retrieval system