Chlorocebus sabaeus (green monkey): 103247166 Help Entry 103247166         CDS       T04361                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04613   Neutrophil extracellular trap formation csab05034   Alcoholism csab05202   Transcriptional misregulation in cancer csab05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103247166  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103247166   09163 Immune disease    05322 Systemic lupus erythematosus     103247166   09165 Substance dependence    05034 Alcoholism     103247166  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csab03036]     103247166   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103247166 Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103247166 Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103247166 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-T_C CBFD_NFYB_HMF YebU_pre-PUA_dom CENP-S Motif Other DBs NCBI-GeneID:  103247166 NCBI-ProteinID:  XP_008017399 LinkDB All DBs Position 20:complement(364892..366189) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATNAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIQAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag ctggccaccaacgccgcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac cgctaccggcccggcaccgtggccctgcgggagatccggcgctaccagaagtccacggag ctgctgatccgcaagctgccgttccagcggctggtacgcgagatcgcgcaggactttaag acggacctgcgcttccagagttctgcggtgatggcgctgcaggaggccagcgaggcctac ctggtggggctgttcgaagacacgaacctgtgcgccatccaggccaagcgcgtgaccatc atgcccaaggacatccagttggcccgccgcatccgcggggagcgggcctaa

DBGET integrated database retrieval system