Chlorocebus sabaeus (green monkey): 103247367 Help Entry 103247367         CDS       T04361                                  Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04270   Vascular smooth muscle contraction csab04530   Tight junction csab04814   Motor proteins csab04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:csab00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     103247367   09142 Cell motility    04814 Motor proteins     103247367  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     103247367   09153 Circulatory system    04270 Vascular smooth muscle contraction     103247367  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csab04812]     103247367    04147 Exosome [BR:csab04147]     103247367 Cytoskeleton proteins [BR:csab04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      103247367 Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103247367   Exosomal proteins of bladder cancer cells    103247367 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 AIF-1 EF_EFCAB10_C EF-hand_5 Motif Other DBs NCBI-GeneID:  103247367 NCBI-ProteinID:  XP_008017660 Ensembl:  ENSCSAG00000019475 UniProt:  A0A0D9SDP0 LinkDB All DBs Position X Genome browser AA seq 151 aa AA seqDB search MWDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEMLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCINYEELVRMVLNG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtgggacttcaccgaagaccagactgcagagttcaaggaggccttccagctgtttgac cgaacaggtgatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggc cagaaccctaccaacgccgagatgctcaaggtcctggggaaccccaagagtgatgagatg aatgtgaaggtgcttgactttgagcactttctgcccatgctgcagacagtggccaagaac aaggaccagggcacctatgaggattatgtcgaaggacttcgggtgtttgacaaggaagga aatggcaccgtcatgggtgctgaaatccggcatgttcttgtcacactgggtgagaagatg acagaggaagaagtagagatgctggtggcagggcacgaggacagcaatggttgtatcaac tatgaagagctcgtccgcatggtgctgaatggctga

DBGET integrated database retrieval system