Chlorocebus sabaeus (green monkey): 103247464 Help Entry 103247464         CDS       T04361                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04814   Motor proteins csab05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csab00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103247464 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103247464 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csab03037]     103247464 (DYNLT3)    04812 Cytoskeleton proteins [BR:csab04812]     103247464 (DYNLT3) Cilium and associated proteins [BR:csab03037]  Motile cilia and associated proteins   Dynein arm    103247464 (DYNLT3) Cytoskeleton proteins [BR:csab04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103247464 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  103247464 NCBI-ProteinID:  XP_008017789 Ensembl:  ENSCSAG00000018056 LinkDB All DBs Position Un Genome browser AA seq 113 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQXIVEQSLTHLVKLGKAYK YIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgctgaggaagcccacaat attgtcaaagagtgtgtagatggggttttaggtggtgaagattataatcacaacaatatc aaccaangcatagtggaacaatccttaacacatttggttaagttgggaaaagcttataaa tatattgtgacctgtgcagtggtccagaagagcgcatatggctttcacacagccagctcc tgcttttgggataccacatctgatggaacctgtaccgtaagatgggagaaccggaccatg aactgtattgtcaatgtttttgccattgctattgttctttaa

DBGET integrated database retrieval system