Chlorocebus sabaeus (green monkey): 103247784 Help Entry 103247784         CDS       T04361                                  Name (RefSeq) C-C motif chemokine 3-like 1   KO K05408   C-C motif chemokine 3 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04620   Toll-like receptor signaling pathway csab05142   Chagas disease csab05163   Human cytomegalovirus infection csab05323   Rheumatoid arthritis csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103247784    04061 Viral protein interaction with cytokine and cytokine receptor     103247784  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103247784    04062 Chemokine signaling pathway     103247784  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103247784   09174 Infectious disease: parasitic    05142 Chagas disease     103247784   09163 Immune disease    05323 Rheumatoid arthritis     103247784   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103247784  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103247784    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103247784 Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103247784 Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Chemokines    103247784 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103247784 NCBI-ProteinID:  XP_008017999 Ensembl:  ENSCSAG00000018395 LinkDB All DBs Position Un Genome browser AA seq 107 aa AA seqDB search MPSSHLVWASLPSSATRGSEAAWPFLLRCAQAHSLPFSAVGADTPTSCCFSYISRQIPQN FIADYFETSSQCSKPGVIFLTKRGRQVCADPSEDWVQKYVSDLELSA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgccttccagtcacttggtctgggcaagcctgccttcctcagccactcggggatcagaa gctgcctggccttttcttctgagatgtgcccaggctcattctcttcctttctccgcagtt ggtgctgacaccccgacctcctgctgcttcagctacatctcccggcagattccacagaat ttcatagctgactactttgagaccagcagccagtgctccaagcccggtgtcatcttccta accaagagaggccggcaggtctgtgctgaccccagtgaggactgggtccagaaatacgtc agcgacctggagctgagtgcctga

DBGET integrated database retrieval system