Chlorocebus sabaeus (green monkey): 103248011 Help Entry 103248011         CDS       T04361                                  Symbol BCL2L1 Name (RefSeq) BCL2 like 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01521   EGFR tyrosine kinase inhibitor resistance csab01524   Platinum drug resistance csab04014   Ras signaling pathway csab04064   NF-kappa B signaling pathway csab04115   p53 signaling pathway csab04137   Mitophagy - animal csab04140   Autophagy - animal csab04151   PI3K-Akt signaling pathway csab04210   Apoptosis csab04215   Apoptosis - multiple species csab04621   NOD-like receptor signaling pathway csab04630   JAK-STAT signaling pathway csab05012   Parkinson disease csab05014   Amyotrophic lateral sclerosis csab05022   Pathways of neurodegeneration - multiple diseases csab05145   Toxoplasmosis csab05162   Measles csab05166   Human T-cell leukemia virus 1 infection csab05168   Herpes simplex virus 1 infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer csab05202   Transcriptional misregulation in cancer csab05212   Pancreatic cancer csab05220   Chronic myeloid leukemia csab05222   Small cell lung cancer csab05225   Hepatocellular carcinoma csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103248011 (BCL2L1)    04630 JAK-STAT signaling pathway     103248011 (BCL2L1)    04064 NF-kappa B signaling pathway     103248011 (BCL2L1)    04151 PI3K-Akt signaling pathway     103248011 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103248011 (BCL2L1)    04137 Mitophagy - animal     103248011 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     103248011 (BCL2L1)    04215 Apoptosis - multiple species     103248011 (BCL2L1)    04115 p53 signaling pathway     103248011 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103248011 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103248011 (BCL2L1)    05202 Transcriptional misregulation in cancer     103248011 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     103248011 (BCL2L1)    05225 Hepatocellular carcinoma     103248011 (BCL2L1)    05220 Chronic myeloid leukemia     103248011 (BCL2L1)    05222 Small cell lung cancer     103248011 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103248011 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     103248011 (BCL2L1)    05162 Measles     103248011 (BCL2L1)    05168 Herpes simplex virus 1 infection     103248011 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103248011 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     103248011 (BCL2L1)    05014 Amyotrophic lateral sclerosis     103248011 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     103248011 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103248011 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103248011 (BCL2L1)    01524 Platinum drug resistance     103248011 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csab01009]     103248011 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csab03036]     103248011 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:csab02000]     103248011 (BCL2L1) Protein phosphatases and associated proteins [BR:csab01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103248011 (BCL2L1) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     103248011 (BCL2L1) Transporters [BR:csab02000]  Other transporters   Pores ion channels [TC:1]    103248011 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  103248011 NCBI-ProteinID:  XP_008018257 Ensembl:  ENSCSAG00000012757 LinkDB All DBs Position 2:complement(36059024..36118332) Genome browser AA seq 280 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQTLREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWERCKVYERYSIPSEYAEKQQAVENKSSIEGAEVEGDMHHGLRNVKNATVYRL GLGRGRHFILPLSKRPEFALEPHPLISHFFATSTFLCHLF NT seq 843 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcaatttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaaacgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggagaggtgcaaggtttatgagaggtattctatccct tcagaatatgcagaaaagcaacaagctgtggaaaataagtcatccattgaaggagctgag gtggaaggggacatgcaccatggactcaggaatgtcaagaatgcaactgtctataggctg ggcctagggcgtggcaggcacttcattttaccactgagcaagagaccagaatttgccctg gaaccccaccccctcatttcccatttctttgcaacttcaacttttctgtgccacctcttc taa

DBGET integrated database retrieval system