Chlorocebus sabaeus (green monkey): 103248587 Help Entry 103248587         CDS       T04361                                  Symbol CD3G Name (RefSeq) CD3g molecule   KO K06452   T-cell surface glycoprotein CD3 gamma chain Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04640   Hematopoietic cell lineage csab04658   Th1 and Th2 cell differentiation csab04659   Th17 cell differentiation csab04660   T cell receptor signaling pathway csab05142   Chagas disease csab05162   Measles csab05166   Human T-cell leukemia virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103248587 (CD3G)    04660 T cell receptor signaling pathway     103248587 (CD3G)    04658 Th1 and Th2 cell differentiation     103248587 (CD3G)    04659 Th17 cell differentiation     103248587 (CD3G)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103248587 (CD3G)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103248587 (CD3G)    05170 Human immunodeficiency virus 1 infection     103248587 (CD3G)    05162 Measles     103248587 (CD3G)    05169 Epstein-Barr virus infection     103248587 (CD3G)   09174 Infectious disease: parasitic    05142 Chagas disease     103248587 (CD3G)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:csab04090]     103248587 (CD3G) CD molecules [BR:csab04090]  Proteins   103248587 (CD3G) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ig_4 Ig_5 ITAM ig Ig_2 Ig_3 Motif Other DBs NCBI-GeneID:  103248587 NCBI-ProteinID:  XP_008019242 Ensembl:  ENSCSAG00000002599 UniProt:  A0A0D9S3K6 LinkDB All DBs Position 1:109721150..109730267 Genome browser AA seq 209 aa AA seqDB search MGGASLAAAQAGWLLRAAPCFCQRTETDMEQGKGLTGFTLAIILLQGSLAQSFEENRKLN VYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDK SKTLQVYYRMCQNCIELNAATILGFVFAEIVSIFFLAVGVYFIAGQDGVRQSRASDKQTL LPNDQLYQPLKDREDDQYSHLQGNQLRRN NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggtggagccagtctagctgctgcacaggctggctggctgctaagggctgctccgtgc ttttgccagaggacagagactgacatggaacaggggaagggcctgactggcttcaccctg gctatcattcttcttcaaggtagtttggcccaatcatttgaagaaaaccgcaagcttaac gtgtataaccaagaagatggttcagtacttctgacttgtcatgtgaaaaacacaaatatc acatggtttaaagaagggaagatgatagacatcctaactgcacataaaaataaatggaat ctgggaagtaataccaaggaccctcgaggggtgtatcagtgtaaaggatcaaaggacaag tcaaaaacactccaagtgtattacagaatgtgtcagaactgcattgaactaaatgcagcc accatattgggctttgtctttgctgaaatcgtcagcattttcttccttgctgttggggtc tacttcattgctggacaggatggagttcgccagtcaagagcttcagacaagcagactctg ttgcccaatgaccagctctaccagcccctcaaggatcgagaagatgaccagtacagtcac cttcaaggaaaccagttgaggaggaattga

DBGET integrated database retrieval system