Cololabis saira (Pacific saury): 133419410 Help Entry 133419410         CDS       T09849                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism csai  Cololabis saira (Pacific saury) Pathway csai04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:csai00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     133419410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csai04121]     133419410    03400 DNA repair and recombination proteins [BR:csai03400]     133419410 Ubiquitin system [BR:csai04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      133419410    Cul5 complex      133419410 DNA repair and recombination proteins [BR:csai03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      133419410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  133419410 NCBI-ProteinID:  XP_061564556 LinkDB All DBs Position 19:complement(10832514..10840749) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLQVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttgatgatccggcgtcacaagacgacaatcttcacagacgccaaggag tccactactgtttatgagctgaagcgtattgtcgaaggaatacttaaaaggccacctgag gaccagcggctctacaaagatgatcagttgctagaggacagcaaaaccctgggggactgc ggattcaccaaccagactgccagacctcaagcaccagctacggttggtctggccttccgt ataaatgatgagatgtttgagcagctgcaagtcgaggccttctccagccccccagaactg cctgatgtgatgaagccccaggactctggtagcactgccaatgagcaggcggtgcagtga

DBGET integrated database retrieval system