Cololabis saira (Pacific saury): 133434970 Help Entry 133434970         CDS       T09849                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism csai  Cololabis saira (Pacific saury) Pathway csai04010   MAPK signaling pathway csai04144   Endocytosis csai04370   VEGF signaling pathway csai04510   Focal adhesion csai04520   Adherens junction csai04530   Tight junction csai04810   Regulation of actin cytoskeleton csai04912   GnRH signaling pathway csai05100   Bacterial invasion of epithelial cells csai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133434970 (cdc42l)    04370 VEGF signaling pathway     133434970 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133434970 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     133434970 (cdc42l)    04520 Adherens junction     133434970 (cdc42l)    04530 Tight junction     133434970 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133434970 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     133434970 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133434970 (cdc42l)    05100 Bacterial invasion of epithelial cells     133434970 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csai04131]     133434970 (cdc42l)    03036 Chromosome and associated proteins [BR:csai03036]     133434970 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133434970 (cdc42l)    04031 GTP-binding proteins [BR:csai04031]     133434970 (cdc42l) Membrane trafficking [BR:csai04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133434970 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     133434970 (cdc42l)   Macropinocytosis    Ras GTPases     133434970 (cdc42l) Chromosome and associated proteins [BR:csai03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     133434970 (cdc42l) Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of microglial cells    133434970 (cdc42l)   Exosomal proteins of breast milk    133434970 (cdc42l) GTP-binding proteins [BR:csai04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133434970 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  133434970 NCBI-ProteinID:  XP_061573079 LinkDB All DBs Position 3:complement(28905767..28912200) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSSVSPSSFENVKEKWVPEISHHCPSTPFLLVGTQVDLR EDSNTVEKLAKNKQRPLYPENGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKKKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgataaaatgtgtagtggtaggagacggggcagtaggaaagacctgcttactg atctcctacacaaccaacaagttcccctcagaatatgtgcctacggtctttgataactat gcagtgacagtaatgattgggggagaaccctacacacttggcctctttgacacagcaggc caggaggattatgacaggctgcgtcctctcagctacccgcaaacagacgtgttccttgta tgtttttccagtgtctccccgtcatcgtttgaaaatgtcaaagaaaagtgggtcccagag atttctcaccactgcccaagcacaccattcctgttggtgggcacacaagtagatctacga gaagacagcaacactgttgagaagctggcaaaaaacaaacagcgccccctttaccccgag aacggggagaagctggcacgtgagctcagggctgttaaatatgtggagtgctcggctctc acacagcgaggacttaagaatgtgtttgatgaggccatactggcagccctggagccccct gagaccaaaacgaagaagaagtgtgttctcctatag

DBGET integrated database retrieval system