Cololabis saira (Pacific saury): 133441026 Help Entry 133441026         CDS       T09849                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism csai  Cololabis saira (Pacific saury) Pathway csai04382   Cornified envelope formation csai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csai00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     133441026 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133441026 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133441026 (s100a10b) Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of microglial cells    133441026 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 Nop5_N CRISPR_Cas9_WED Motif Other DBs NCBI-GeneID:  133441026 NCBI-ProteinID:  XP_061574383 LinkDB All DBs Position 3:26554545..26555719 Genome browser AA seq 99 aa AA seqDB search MTELERSMESLIMVFHRYAKEGGDKKTLNKKEMKKLIEAELPNFLKTQKDPHTLDRIMKD LDQNRDDELDFEEFVPFVAGLSIACEKHFALHQDKKGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgacagagttggaaagatccatggagtccctgataatggtgttccaccgctatgccaaa gaaggcggagacaaaaagaccttaaacaagaaggaaatgaaaaagctgatagaggctgag ttgcccaactttctgaaaacccagaaagaccctcacactttggaccgcatcatgaaagac ctggaccaaaacagggatgatgagttggattttgaagagtttgtaccgttcgttgccggc ctctcaattgcgtgtgaaaagcactttgctttgcaccaagataaaaagggcaagaagtga

DBGET integrated database retrieval system