Cololabis saira (Pacific saury): 133444043 Help Entry 133444043         CDS       T09849                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism csai  Cololabis saira (Pacific saury) Pathway csai04010   MAPK signaling pathway csai04012   ErbB signaling pathway csai04068   FoxO signaling pathway csai04137   Mitophagy - animal csai04140   Autophagy - animal csai04144   Endocytosis csai04150   mTOR signaling pathway csai04210   Apoptosis csai04218   Cellular senescence csai04370   VEGF signaling pathway csai04371   Apelin signaling pathway csai04510   Focal adhesion csai04540   Gap junction csai04625   C-type lectin receptor signaling pathway csai04810   Regulation of actin cytoskeleton csai04910   Insulin signaling pathway csai04912   GnRH signaling pathway csai04916   Melanogenesis csai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133444043 (hrasa)    04012 ErbB signaling pathway     133444043 (hrasa)    04370 VEGF signaling pathway     133444043 (hrasa)    04371 Apelin signaling pathway     133444043 (hrasa)    04068 FoxO signaling pathway     133444043 (hrasa)    04150 mTOR signaling pathway     133444043 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133444043 (hrasa)    04140 Autophagy - animal     133444043 (hrasa)    04137 Mitophagy - animal     133444043 (hrasa)   09143 Cell growth and death    04210 Apoptosis     133444043 (hrasa)    04218 Cellular senescence     133444043 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     133444043 (hrasa)    04540 Gap junction     133444043 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133444043 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133444043 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     133444043 (hrasa)    04912 GnRH signaling pathway     133444043 (hrasa)    04916 Melanogenesis     133444043 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133444043 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csai04131]     133444043 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133444043 (hrasa)    04031 GTP-binding proteins [BR:csai04031]     133444043 (hrasa) Membrane trafficking [BR:csai04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     133444043 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     133444043 (hrasa) Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    133444043 (hrasa)   Exosomal proteins of colorectal cancer cells    133444043 (hrasa) GTP-binding proteins [BR:csai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     133444043 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  133444043 NCBI-ProteinID:  XP_061577467 LinkDB All DBs Position 5:complement(28970213..28989413) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PTRSVDTKQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtagtgggcgctggaggtgtgggcaagagcgcactaacc atccagctcatccagaaccactttgtggatgaatatgacccaactatagaggattcatac cggaaacaagtggtgattgatggggagacttgcctgctggatatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgagaacaggggagggcttcctctgc gtctttgccatcaacaacaccaagtcctttgaggacattcaccagtacagagagcagatt aaacgagtaaaggattccgatgacgtacccatggtgcttgtgggaaataagtgtgactta ccaacacgttcggtggacacaaagcaagcccaggacctcgctcgctcctacggaattcct tacattgaaacctctgccaaaacgcgacagggagtggaggatgctttctacacgctggtg cgggagataagacagcataagctgaggaagctgaacccacctgatgagagtggtcaagac tgtatgagctgtcgatgtgtggtgtcttga

DBGET integrated database retrieval system