Cololabis saira (Pacific saury): 133444386 Help Entry 133444386         CDS       T09849                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism csai  Cololabis saira (Pacific saury) Pathway csai04010   MAPK signaling pathway csai04012   ErbB signaling pathway csai04068   FoxO signaling pathway csai04137   Mitophagy - animal csai04140   Autophagy - animal csai04150   mTOR signaling pathway csai04210   Apoptosis csai04218   Cellular senescence csai04370   VEGF signaling pathway csai04371   Apelin signaling pathway csai04540   Gap junction csai04625   C-type lectin receptor signaling pathway csai04810   Regulation of actin cytoskeleton csai04910   Insulin signaling pathway csai04912   GnRH signaling pathway csai04914   Progesterone-mediated oocyte maturation csai04916   Melanogenesis Brite KEGG Orthology (KO) [BR:csai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133444386 (kras)    04012 ErbB signaling pathway     133444386 (kras)    04370 VEGF signaling pathway     133444386 (kras)    04371 Apelin signaling pathway     133444386 (kras)    04068 FoxO signaling pathway     133444386 (kras)    04150 mTOR signaling pathway     133444386 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133444386 (kras)    04137 Mitophagy - animal     133444386 (kras)   09143 Cell growth and death    04210 Apoptosis     133444386 (kras)    04218 Cellular senescence     133444386 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     133444386 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133444386 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133444386 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     133444386 (kras)    04912 GnRH signaling pathway     133444386 (kras)    04914 Progesterone-mediated oocyte maturation     133444386 (kras)    04916 Melanogenesis     133444386 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csai04131]     133444386 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:csai04031]     133444386 (kras) Membrane trafficking [BR:csai04131]  Endocytosis   Macropinocytosis    Ras GTPases     133444386 (kras) GTP-binding proteins [BR:csai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     133444386 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  133444386 NCBI-ProteinID:  XP_061578124 LinkDB All DBs Position 5:41275745..41291388 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRSVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRLFRLSKLCKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagctggttgtggtgggagctggaggcgtcggcaagagcgcactcacc attcagctcatccaaaatcactttgtggatgaatatgaccccaccattgaggactcttac agaaagcaggtggtgattgatggagagacatgtctactggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggaccggggaggggttcctctgt gtctttgccatcaacaacaccaagtcctttgaggacattcaccactatagagaacagatt aagcgggtgaaggactcggaggacgtcccgatggtgctggtggggaacaagtgtgacctc ccgtcccggtcggtggacacaaagcaggctcaggacttagcgcgcagctatggcattccc tttatcgagacctcagccaaaaccagacagagagtggaagatgccttttacactctggta cgagagatcaggctgttccggctcagtaaactctgcaaggaagaaaagaccccgcgctgt gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system