Cololabis saira (Pacific saury): 133444670 Help Entry 133444670         CDS       T09849                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism csai  Cololabis saira (Pacific saury) Brite KEGG Orthology (KO) [BR:csai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csai03019]     133444670 (mt2)    03029 Mitochondrial biogenesis [BR:csai03029]     133444670 (mt2) Messenger RNA biogenesis [BR:csai03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      133444670 (mt2) Mitochondrial biogenesis [BR:csai03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     133444670 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  133444670 NCBI-ProteinID:  XP_061578522 LinkDB All DBs Position 5:23732832..23733668 Genome browser AA seq 60 aa AA seqDB search MDPCDCAKSGKCNCAGSCSCSNCSCTSCKKSCCPCCPTGCPKCASGCVCKGKTCDTACCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccttgcgattgcgctaagagtggaaaatgcaactgcgcaggatcctgctcctgc tccaactgctcctgcaccagctgcaagaagagctgctgcccctgctgccccacaggctgc cctaaatgtgcctctggctgcgtgtgcaaagggaagacctgtgacactgcctgctgccag tga

DBGET integrated database retrieval system