Cololabis saira (Pacific saury): 133447659 Help Entry 133447659         CDS       T09849                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism csai  Cololabis saira (Pacific saury) Pathway csai04010   MAPK signaling pathway csai04068   FoxO signaling pathway csai04081   Hormone signaling csai04114   Oocyte meiosis csai04140   Autophagy - animal csai04150   mTOR signaling pathway csai04810   Regulation of actin cytoskeleton csai04910   Insulin signaling pathway csai04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:csai00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     133447659    04150 mTOR signaling pathway     133447659   09133 Signaling molecules and interaction    04081 Hormone signaling     133447659  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133447659  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csai04052]     133447659 Cytokines and neuropeptides [BR:csai04052]  Neuropeptides   Unclassified    133447659 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  133447659 NCBI-ProteinID:  XP_061582366 LinkDB All DBs Position 7:37337408..37340081 Genome browser AA seq 111 aa AA seqDB search MARVSWAVLLLFLLVVYSPGAPSVPVQHLCGSHLVDALYFICGERGFYYNPKRANKRDLS HLLGFLSKRGKQEERLWRVGSGHEEPKVKRGIVEQCCHNPCSLHHLEGYCD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtatcatgggcggtcctgctgctcttcctgctggtggtctactctccaggg gctccctccgtccccgtccagcacctgtgcggctcccacctagtggacgccctctacttc atatgtggagagcgagggttttactacaatccaaagcgagccaacaagcgggacctgtca catttgctggggttcctctctaaacggggaaaacaagaagagcggctgtggagggtcggg tctggccacgaagagcccaaggtgaagcgaggcatcgtggagcagtgctgccataaccca tgcagccttcaccacctggagggctactgcgactga

DBGET integrated database retrieval system