Cololabis saira (Pacific saury): 133448513 Help Entry 133448513         CDS       T09849                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism csai  Cololabis saira (Pacific saury) Pathway csai03030   DNA replication csai03410   Base excision repair csai03420   Nucleotide excision repair csai03430   Mismatch repair csai03440   Homologous recombination Brite KEGG Orthology (KO) [BR:csai00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     133448513 (pold4)    03410 Base excision repair     133448513 (pold4)    03420 Nucleotide excision repair     133448513 (pold4)    03430 Mismatch repair     133448513 (pold4)    03440 Homologous recombination     133448513 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:csai03032]     133448513 (pold4)    03400 DNA repair and recombination proteins [BR:csai03400]     133448513 (pold4) DNA replication proteins [BR:csai03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     133448513 (pold4) DNA repair and recombination proteins [BR:csai03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       133448513 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      133448513 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  133448513 NCBI-ProteinID:  XP_061583097 LinkDB All DBs Position 1:complement(52770399..52994014) Genome browser AA seq 108 aa AA seqDB search MTTKRGLITDSFKVVKKSRKARKRQKSVTPPPPQTEDVAKTAREEELQRLRQFDLDWKFG PCTGISRLQRWERADLHGLNPPEEIRDLLLLTHTDPEYTLSLWNEYPF NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaagcgtggactgataacagattccttcaaggttgtgaagaaatcccggaaa gcgaggaagcggcagaaaagcgtcacaccacctccaccacagacagaggatgtggctaaa acggcccgggaggaggagctacagaggctcagacagtttgacctggactggaaatttggg ccgtgcacaggcatcagcaggctgcagaggtgggagagagcagatctgcacggtctgaac ccacctgaggagatcagagacctgctgctgctgacgcacaccgaccccgagtacacactc agcctgtggaacgaatatcctttctga

DBGET integrated database retrieval system