Cololabis saira (Pacific saury): 133448747 Help Entry 133448747         CDS       T09849                                  Symbol myl6 Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism csai  Cololabis saira (Pacific saury) Pathway csai04270   Vascular smooth muscle contraction csai04517   IgSF CAM signaling csai04530   Tight junction csai04814   Motor proteins Brite KEGG Orthology (KO) [BR:csai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133448747 (myl6)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     133448747 (myl6)   09142 Cell motility    04814 Motor proteins     133448747 (myl6)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     133448747 (myl6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csai04812]     133448747 (myl6)    04147 Exosome [BR:csai04147]     133448747 (myl6) Cytoskeleton proteins [BR:csai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      133448747 (myl6) Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    133448747 (myl6)   Exosomal proteins of bladder cancer cells    133448747 (myl6) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 CFAP251_C EF_EFCAB10_C AIF-1 EF-hand_8 Motif Other DBs NCBI-GeneID:  133448747 NCBI-ProteinID:  XP_061583565 LinkDB All DBs Position 8 Genome browser AA seq 152 aa AA seqDB search MMSDFTEDQILEFKEAFLLFDRTGEGKITYSQCGDVMRALGQNPVNAEVLKVLGNPKLEE MNHKMLDFEQFLPMLQAIAKNKDQGSFEDIVEGLRVFDKEGNGTVMGAELRHVLTTLGEK MTEEEVETLLAGHEDANGCINYEELVRMVMSG NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgatgtctgactttacagaggatcagattttggagttcaaggaggcctttctgttgttt gaccgcacgggtgaggggaaaatcacctacagccagtgtggggatgtaatgcgagccctg ggacagaaccctgtcaatgctgaggtgctcaaagtgctgggaaaccccaagttagaagag atgaaccataaaatgctggattttgagcagttcctccccatgcttcaggccatcgctaaa aacaaagaccagggttcttttgaggatattgttgaaggcctgcgtgtctttgacaaagag ggtaatggcacagtgatgggagcagagctgcgtcatgtcctcaccacattaggtgaaaaa atgacagaagaagaagtagagactcttttagcaggacatgaggatgccaacggctgcatc aactatgaagaacttgtccggatggtgatgagcggttga

DBGET integrated database retrieval system