Cololabis saira (Pacific saury): 133448771 Help Entry 133448771         CDS       T09849                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism csai  Cololabis saira (Pacific saury) Pathway csai04137   Mitophagy - animal csai04140   Autophagy - animal csai04144   Endocytosis csai04145   Phagosome csai04148   Efferocytosis csai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csai00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133448771 (rab7a)    04145 Phagosome     133448771 (rab7a)    04140 Autophagy - animal     133448771 (rab7a)    04137 Mitophagy - animal     133448771 (rab7a)    04148 Efferocytosis     133448771 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133448771 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csai04131]     133448771 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133448771 (rab7a)    04031 GTP-binding proteins [BR:csai04031]     133448771 (rab7a) Membrane trafficking [BR:csai04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     133448771 (rab7a) Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133448771 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    133448771 (rab7a)   Exosomal proteins of colorectal cancer cells    133448771 (rab7a)   Exosomal proteins of bladder cancer cells    133448771 (rab7a) GTP-binding proteins [BR:csai04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     133448771 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  133448771 NCBI-ProteinID:  XP_061583607 LinkDB All DBs Position 8:28805916..28813893 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSQESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttccaggaagaaagtgctcttgaaagtcatcatcctgggcgattctggtgttgga aaaacctccctaatgaaccagtatgtgaacaaaaagttcagtaaccagtacaaagctaca ataggagcagacttcttgaccaaggaggtgatggtggatgaccggcttgttacaatgcag atctgggacacagctggccaggagaggttccagtctctgggagttgcgttctatcgtggg gctgattgctgcgtgctggtgtttgatgtgactgcacccaataccttcaagacactcgac agctggagggatgaatttctaatccaggccagcccccgagaccctgagaacttccccttc gtggtgctaggcaacaagattgacttggagaatagacaggtgaccaccaaaagggctcag gcttggtgtcagagtaagaacaacatcccctactttgagaccagtgccaaagaagccata aatgtagaacaggcattccagacaattgcacgtaacgcccttaaacaggagacagaagtc gagttgtataatgaatttccagagcccataaagctggataggaatgacagagctaaaccc tctcaagagagctgcagctgctga

DBGET integrated database retrieval system