Cololabis saira (Pacific saury): 133457136 Help Entry 133457136         CDS       T09849                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism csai  Cololabis saira (Pacific saury) Pathway csai04081   Hormone signaling csai04144   Endocytosis csai04150   mTOR signaling pathway csai04270   Vascular smooth muscle contraction csai04310   Wnt signaling pathway csai04350   TGF-beta signaling pathway csai04510   Focal adhesion csai04517   IgSF CAM signaling csai04519   Cadherin signaling csai04520   Adherens junction csai04530   Tight junction csai04621   NOD-like receptor signaling pathway csai04625   C-type lectin receptor signaling pathway csai04810   Regulation of actin cytoskeleton csai05100   Bacterial invasion of epithelial cells csai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csai00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     133457136    04350 TGF-beta signaling pathway     133457136    04150 mTOR signaling pathway     133457136   09133 Signaling molecules and interaction    04081 Hormone signaling     133457136    04517 IgSF CAM signaling     133457136    04519 Cadherin signaling     133457136  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133457136   09144 Cellular community - eukaryotes    04510 Focal adhesion     133457136    04520 Adherens junction     133457136    04530 Tight junction     133457136   09142 Cell motility    04810 Regulation of actin cytoskeleton     133457136  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     133457136    04625 C-type lectin receptor signaling pathway     133457136   09153 Circulatory system    04270 Vascular smooth muscle contraction     133457136  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133457136    05100 Bacterial invasion of epithelial cells     133457136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csai04131]     133457136   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133457136    04031 GTP-binding proteins [BR:csai04031]     133457136 Membrane trafficking [BR:csai04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     133457136 Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133457136   Exosomal proteins of other body fluids (saliva and urine)    133457136   Exosomal proteins of colorectal cancer cells    133457136   Exosomal proteins of bladder cancer cells    133457136 GTP-binding proteins [BR:csai04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     133457136 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  133457136 NCBI-ProteinID:  XP_061592035 LinkDB All DBs Position 12:complement(23322862..23327884) Genome browser AA seq 242 aa AA seqDB search MTEIIKMTHAQVRTQPAGLLRHCAHARKLWAEFSSRSGRRERRTEKHKEMAAIRKKLVIV GDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRREL AKMKQEPVKFEEGKEMASRISAYGYQECSAKTKDGVREVFEMATRAALQAKKNRKKPTCV LL NT seq 729 nt NT seq  +upstreamnt  +downstreamnt atgacagaaataatcaagatgacgcatgcgcaggtccgcactcagcctgctggtttatta cgtcattgcgcgcatgcgcgcaagctgtgggcggagttttccagtcggtcaggaagacga gaaagacggacagagaaacataaagagatggctgccatcaggaagaagttggtgatagtt ggggatggagcttgcgggaagacgtgtctgctgatcgttttcagtaaggaccagttccca gaggtctacgtgcccactgtgtttgagaactatgtggcagacatcgaagtagatggtaaa caggtagaactggctctttgggatacagcaggtcaggaagactatgaccgactgaggcct ctgtcctacccagacaccgatgtcatcctcatgtgcttctctgtggacagcccggacagt ttagagaatattccagaaaagtggactcctgaagttaaacacttttgtccaaatgttccc atcatcctggttggaaacaaaaaagatttgcgcaatgacgagcacactcgacgcgagctt gccaaaatgaaacaggaaccagttaaatttgaagaaggcaaagagatggcaagccgcatc agtgcctatggttaccaagagtgttctgccaaaaccaaagacggtgtgagggaagtcttt gagatggcaactagggcagcattacaggccaagaaaaacaggaagaagcctacctgtgta ttgttatag

DBGET integrated database retrieval system