Cololabis saira (Pacific saury): 133461356 Help Entry 133461356         CDS       T09849                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism csai  Cololabis saira (Pacific saury) Pathway csai04382   Cornified envelope formation csai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csai00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     133461356  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133461356  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133461356 Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of microglial cells    133461356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH Motif Other DBs NCBI-GeneID:  133461356 NCBI-ProteinID:  XP_061598226 LinkDB All DBs Position 15:complement(5729240..5735197) Genome browser AA seq 100 aa AA seqDB search MPSELEIAMESLIKVFHRYASKDGREGTLSRRELRELMENELSGFLRSQKDPAAVDKIMK DLDANGDGQVDFEEFVSLVVGLSIACEQCYTMHMKKLGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagagttggagatagccatggaatcactcatcaaggtgttccaccgttacgcc tctaaggacggtcgtgaaggcacactcagccggcgagagctcagagagctcatggagaac gagctctccggcttcctcaggtcccagaaggatcctgctgctgtggacaagatcatgaag gacctggatgccaacggggacggccaggtggactttgaggagtttgtttccctggttgtt ggactctccattgcctgtgagcagtgctatacgatgcacatgaagaagttgggaaagaag taa

DBGET integrated database retrieval system