Cololabis saira (Pacific saury): 133464536 Help Entry 133464536         CDS       T09849                                  Symbol arf6a Name (RefSeq) ADP-ribosylation factor 6a   KO K07941   ADP-ribosylation factor 6 Organism csai  Cololabis saira (Pacific saury) Pathway csai04144   Endocytosis csai04517   IgSF CAM signaling csai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133464536 (arf6a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133464536 (arf6a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133464536 (arf6a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csai04131]     133464536 (arf6a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133464536 (arf6a)    04031 GTP-binding proteins [BR:csai04031]     133464536 (arf6a) Membrane trafficking [BR:csai04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133464536 (arf6a)   Arf GTPases and associated proteins    Arf GTPases     133464536 (arf6a) Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133464536 (arf6a)   Exosomal proteins of colorectal cancer cells    133464536 (arf6a) GTP-binding proteins [BR:csai04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     133464536 (arf6a) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  133464536 NCBI-ProteinID:  XP_061602561 LinkDB All DBs Position 18:31579534..31582128 Genome browser AA seq 175 aa AA seqDB search MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaaatgctttcaaagatcttcggcaacaaggagatgagaatactgatgcttgga cttgatgctgctgggaaaactacgatcctgtacaagctgaaactgggacagtcggtcacc accatccccacggtggggttcaacgtggagacggtcacctataagaatgtgaagttcaac gtgtgggacgtgggcggacaggacaagatccggcccctctggagacattactacacgggc acccagggcctgattttcgtggtggactgtgctgacagggacaggatcgacgaggcgagg caggagctccaccggatcatcaacgaccgggagatgagggacgccatcatcctgatcttt gccaacaagcaagacctcccggatgccatgaaaccccacgagatccaggagaagctgggt ctcacccggataagagataggaattggtacgttcagccctcgtgtgcaacgacgggggat ggactgtacgagggcctgacctggcttacctcaaattacaaatcgtaa

DBGET integrated database retrieval system