Chryseobacterium salivictor: NBC122_00029 Help Entry NBC122_00029      CDS       T07515                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism csal  Chryseobacterium salivictor Pathway csal01100   Metabolic pathways csal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NBC122_00029 (acpP_1)    00074 Mycolic acid biosynthesis     NBC122_00029 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NBC122_00029 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Spectrin_SYNE1 Motif Other DBs NCBI-ProteinID:  QBO56890 UniProt:  A0A4P6ZBP8 LinkDB All DBs Position 30528..30782 Genome browser AA seq 84 aa AA seqDB search MNKEEAIQKLKEIVKPYVKEAELLKNINENTDFINDLNINSANLVDVVLDVEEVFDIEID AASMEKMRDVKSALAVIEEKLAIK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggaagaggctattcaaaaattaaaagagattgtaaaaccttacgtgaaagag gcggaacttttaaaaaacattaatgaaaatacagatttcattaatgatctcaatattaat tctgctaatttagtcgatgtcgttttagatgtggaggaggttttcgatattgaaatcgac gcggcatcgatggagaagatgcgggatgtaaaatctgcgctggcggtcatcgaagagaaa ttggcgataaaataa

DBGET integrated database retrieval system