Camelina sativa (false flax): 104699912 Help Entry 104699912         CDS       T05044                                  Name (RefSeq) SKP1-like protein 13   KO K03094   S-phase kinase-associated protein 1 Organism csat  Camelina sativa (false flax) Pathway csat03083   Polycomb repressive complex csat04120   Ubiquitin mediated proteolysis csat04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csat00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104699912    04120 Ubiquitin mediated proteolysis     104699912   09126 Chromosome    03083 Polycomb repressive complex     104699912  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104699912    04121 Ubiquitin system [BR:csat04121]     104699912    03036 Chromosome and associated proteins [BR:csat03036]     104699912 Membrane trafficking [BR:csat04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104699912 Ubiquitin system [BR:csat04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104699912    Cul7 complex      104699912 Chromosome and associated proteins [BR:csat03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104699912   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104699912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Clr5 Motif Other DBs NCBI-GeneID:  104699912 NCBI-ProteinID:  XP_010413610 UniProt:  A0ABM0SN07 LinkDB All DBs Position 7:2130203..2130866 Genome browser AA seq 153 aa AA seqDB search MSKKIMLKSSDGEAFEIEEAVASQSQTIAHMIEDDCVATEIPLANVKGTTLAMVIEYCKK HAGADASTGEGKEELKKWDADFLKTMEQPTLFDVILAANYLNIKDLLDISCQAVADMISG KKPEEIRALLGIQNDFTPDEEEEFRKENEWAFE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagaagattatgttgaagagttccgatggcgaggcgtttgagatcgaggaagca gtcgcaagccagtcgcagacgatagcacatatgattgaagacgattgcgtcgctactgag atccctctcgcaaacgtcaaaggaaccaccctcgcgatggtgatcgagtattgcaagaag cacgctggtgctgatgcttcaaccggcgagggcaaagaggaactcaagaagtgggacgct gacttcttgaagacgatggaacaacccactctttttgatgttattttggctgctaattac ctaaacattaaagacctccttgatatttcttgccaagctgttgctgacatgatctctggt aaaaagccagaagagattcgcgcacttttgggcatccagaacgattttacaccggatgaa gaggaagagttccgcaaggagaatgagtgggcgtttgaatga

DBGET integrated database retrieval system