KEGG   Camelina sativa (false flax): 104703790
Entry
104703790         CDS       T05044                                 
Name
(RefSeq) protein DETOXIFICATION 37
  KO
K03327  MATE family, multidrug and toxin extrusion protein
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csat02000]
    104703790
Transporters [BR:csat02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   104703790
SSDB
Motif
Pfam: MatE
Other DBs
NCBI-GeneID: 104703790
NCBI-ProteinID: XP_010418166
UniProt: A0ABM0SYZ2
LinkDB
Position
7:complement(32056800..32067595)
AA seq 501 aa
MNSESLENLHRPLIESSKSFVDYRLETVLTDRELPYFRRIYLAMMIEMKFLLHLAAPAIF
VYVINNGMSILTRIFAGHVGSFELAAASLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAH
RYEMLGVYLQRSTLVLIITCLPMSFLFLFSNPILTSLGEPEQVATLASVFVYGMIPVIFA
YAVNFPIQKFLQAQSIVTPSAYISAATLVIHLLLSWIAVYRLGYGLLALSLIHSFSWWII
VVAQIVYIKMSPRCRRTWEGFSWKAFEGLWDFFRLSAASAVMLCLESWYSQILVLLAGLL
KDPELALDSLAICMSISAISFMVSVGFNAAASVRVSNELGAGNPRAAAFSTVVTTGVSFL
LAIFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ
AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE
VAKASSRLDQWEESREPLLKQ
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaattcagaatcgttagaaaacctccaccgtccactgatcgaatcatcgaaatcgttc
gttgattatcgtctcgagactgtgttgacggatcgagagttaccgtattttcgaaggatt
tatctggcgatgatgatcgagatgaagtttctcttacatttggctgctccggcgatcttt
gtttacgttatcaacaacggtatgtcgattctcacacgtatcttcgccggtcacgttggt
agcttcgaactcgccgccgcttcgcttggtaacagcggattcaatatgtttacgtatggt
cttttgcttggaatgggaagtgcagtagagacgttatgtggtcaagcacatggagcacat
agatacgaaatgcttggagtttaccttcaaaggtcaacgttggttctaatcataacatgt
ctaccaatgtcatttctgttcctcttctcgaatccaatcctcacttcactcggagagccg
gaacaagtcgcaacattagcttcagtgttcgtatacggtatgatcccagtgatctttgct
tacgcggttaatttcccgatccagaagtttctccaagcgcagagtatcgtcactccaagc
gcttacatctcagccgcaacgctcgtgatccatctccttctctcgtggatagctgtgtac
cgtcttggttacggtctcttggctttgtccttgattcatagcttctcgtggtggatcatt
gtggtggctcagattgtttatattaagatgagtccgaggtgtcgtcggacttgggaaggt
tttagttggaaagcttttgaaggtctttgggattttttccggttatcggcagcttctgcg
gtcatgctttgtcttgaatcttggtactcacagattcttgttttgctcgccggacttctc
aaggaccctgagcttgctttggattctctagctatctgcatgtcaatttctgcgatctcg
ttcatggtctccgttggattcaatgcagctgcaagtgtgagagtaagcaatgaattagga
gctggaaacccgagagcagccgcgttttccacagttgttacgacgggagtatctttctta
ctagcgatattcgaagccatcgtggtcttatcgtggcgaaatgtcatcagctatgcgttt
actgatagtcccgcggtggccgaggctgttgccgatttatctccctttctagccatcaca
attgtcctcaacgggattcagcctgttttgtcaggtgttgcggttggatgtggatggcaa
gcatttgtggcgtacgttaacattggatgttactacgttgtggggataccaattggcttc
gttcttgggttcacttatgatatgggagctaagggtatatggacagggatgattggtggt
acattaatgcagacgataatcttagttattgtcactttccgaacggactgggacaaagag
gttgcgaaagcttcgagtagactggaccagtgggaagagagccgtgagccacttttgaag
caataa

DBGET integrated database retrieval system