Camelina sativa (false flax): 104726888 Help Entry 104726888         CDS       T05044                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism csat  Camelina sativa (false flax) Pathway csat04144   Endocytosis csat04145   Phagosome csat04148   Efferocytosis Brite KEGG Orthology (KO) [BR:csat00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104726888    04145 Phagosome     104726888    04148 Efferocytosis     104726888  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104726888   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csat04147]     104726888    04031 GTP-binding proteins [BR:csat04031]     104726888 Membrane trafficking [BR:csat04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     104726888 Exosome [BR:csat04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104726888   Exosomal proteins of other body fluids (saliva and urine)    104726888   Exosomal proteins of colorectal cancer cells    104726888   Exosomal proteins of bladder cancer cells    104726888 GTP-binding proteins [BR:csat04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     104726888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  104726888 NCBI-ProteinID:  XP_010444143 LinkDB All DBs Position 11:47096999..47098937 Genome browser AA seq 120 aa AA seqDB search MSLQVFIVDDKWVAKTSLVTKFLHDNPGDANGRQNQEYEKQIWIDNRKWNLEIIVGNECW LCIPGYDHVACCVLVYDVYNRQSFENLTKHIEEFFVLANPKAYKFKFVVLGNKIDKIGER NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgagtctacaggttttcatagttgatgacaaatgggttgctaaaacatcattggtaacg aagtttctccatgataaccctggggatgcgaatggacggcaaaatcaagagtatgaaaaa caaatctggattgataatcgaaagtggaatttggagataatagttggtaatgagtgttgg ctgtgtattcctggatatgatcacgtggcttgttgtgttctcgtctacgatgtctacaac aggcaatcgtttgagaatctcactaagcatattgaagagttctttgtcttggctaatcca aaagcctataaattcaagttcgttgtcttggggaacaagattgacaagataggggaacga tga

DBGET integrated database retrieval system