KEGG   Camelina sativa (false flax): 104746960
Entry
104746960         CDS       T05044                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104746960
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104746960
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     104746960
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 104746960
NCBI-ProteinID: XP_010466820
LinkDB
Position
15:complement(16421666..16425512)
AA seq 609 aa
MQATIFSPRATLFPCKPLHPSHNVNSRNRPSTFSCSVQSVTADPSPPATDANKLNKYSSR
ITEPKSQGGSQAILHGVGLSDDDLLKPQVGISSVWYEGNTCNMHLLKLSEAVKEGVQNAG
MVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPG
TIMAMGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSC
PGAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLLELLRMDLKP
RDIITPKSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKP
SGKYVMEDIHKIGGTPAVLRFLLEHGFMDGDCMTVTGQTLAQNLENVPSLSEGQEIIRPV
SNPIKETGHIQILRGDLAPDGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKG
TVVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQ
EGGPIGLIENGDIITIDIGKKRIDTQVSPEEMNERRKKWTAPAYKVNRGVLYKYIKNVQS
ASDGCVTDE
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgcaagccaccatcttctccccacgcgccaccctcttcccctgtaaacctctccaccct
tcccacaatgtcaactctcgcaaccgcccctcaaccttctcctgctctgttcaatccgtg
accgctgatccttccccacccgccactgacgccaacaagctcaacaagtacagctcgaga
atcaccgaacccaaatcccaaggtgggtctcaagcgattcttcacggtgtgggtttgtca
gacgacgatttgctgaaaccccaagttggtatctcgtcggtgtggtacgaagggaacact
tgtaatatgcatttgctgaagttgtctgaggctgtgaaagaaggagttcaaaacgctggg
atggttgggtttaggtttaatacgattggtgttagtgatgctatctcgatgggaacgaga
gggatgtgttttagtttgcagtctagggatttgattgctgatagtattgagactgtaatg
agtgctcagtggtatgatggcaacatatctattcctggttgtgataaaaatatgcctgga
actattatggctatgggaaggcttaacagaccaggcattatggtttatggtggaaccatt
aagcctggccattttcaagaaaagacgtatgacatagtatctgctttccagagttatgga
gaatttgttagtggttctataagtgatgaacagagaaagactgtcctccatcattcatgt
cctggagctggagcctgtggtggtatgtacacagctaacacaatggcttctgcaatcgaa
gccatgggaatgtcccttccttacagctcttcgataccagctgaagacccattaaaattg
gacgagtgccgtttagctggtaaatatcttttagaattgctaagaatggacttgaaacca
cgggatattatcactccaaaatcacttcgtaatgcaatggttactgtcatggcccttgga
ggatcgacaaatgctgtattgcatctaattgctattgcaaggtctgttggtttggagttg
acccttgatgattttcagaaggtcagcgatgcggttccgtttctggcagatctgaaaccc
agtgggaaatatgttatggaggatatacataagattggtggcacaccagctgttcttcgc
tttctattagagcatggatttatggatggggattgtatgacagtcacagggcagactttg
gctcaaaatttagaaaacgtccccagcttaagtgaagggcaggagataattagacctgtg
tcaaatccaatcaaggagactggacacatacaaatcttgcgaggagaccttgcaccagat
ggttctgtagcaaaaattaccggcaaagagggattatatttctctggtcctgcgcttgta
tttgaaggagaggaatctatgcttgctgctatatcagcagacccaatgagttttaaggga
acagtggttgttatcagaggagaggggcctaaaggaggtccaggtatgcctgagatgttg
acaccaacaagtgcaataatgggtgccggtcttggaaaggaatgtgcattactgactgat
ggtaggttctctggtgggtcacacggttttgttgttggccacatttgccctgaagctcag
gagggtggtccgatcggtctgatagagaatggagacataatcaccattgacataggaaag
aagagaatagacacacaagtttcacccgaagaaatgaatgagcgtagaaagaaatggact
gctcctgcatacaaggttaaccgcggagttctatacaagtacatcaagaacgtgcaatcg
gcttcagatggatgtgtgactgatgagtaa

KEGG   Camelina sativa (false flax): 104766349
Entry
104766349         CDS       T05044                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic isoform X1
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104766349
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104766349
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     104766349
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 104766349
NCBI-ProteinID: XP_010488520
LinkDB
Position
19:complement(14541695..14547484)
AA seq 609 aa
MQATIFSPRATLFPCKPLHPSHNVNSRNRPSTFFCSVQSVTADPSPPATDSNKLNKYSSR
ITEPKSQGGSQAILHGVGLSDDDLLKPQVGISSVWYEGNTCNMHLLKLSEAVKEGVENAG
MVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPG
TIMAMGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSC
PGAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLLELLRMDLKP
RDIITPQSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKP
SGKYVMEDIHKIGGTPAVLRFLLEHGFMDGDCMTVTGQTLAQNLENVSSLSEGQEIIRPV
SNPIKETGHIQILRGDLAPDGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKG
TVVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQ
EGGPIGLVENGDIITIDIGKKRIDTQVSPEEMNERRKKWTAPAYKVNRGVLYKYIKNVQS
ASDGCVTDE
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgcaagccaccatcttctccccacgcgccaccctcttcccttgtaaacctctccaccct
tcccacaatgtcaactctcgcaaccgcccctcaaccttcttctgctctgttcaatccgtg
accgctgatccttccccacccgccactgactccaacaagctcaacaagtacagctcgaga
atcaccgaacccaaatcccaaggtgggtctcaagcgattcttcacggtgtgggtttatca
gacgacgatttgctgaaaccccaagttggtatctcgtcggtgtggtacgaagggaacact
tgtaatatgcatttgctgaagttgtctgaggctgtgaaagaaggagttgagaatgctggg
atggttgggtttaggtttaatacgattggtgtgagtgatgctatctcgatgggaacgaga
gggatgtgttttagtttgcagtctagggatttgattgctgatagtattgagactgtgatg
agtgcacaatggtatgatggcaacatatctattcctggttgtgataaaaatatgcctgga
actattatggctatgggaaggcttaacagaccaggcattatggtttatggtggaaccatt
aagcctggccattttcaagaaaagacatatgacatagtatctgctttccagagttatgga
gaatttgttagtggttctataagtgatgaacagagaaagactgtcctccatcattcatgt
cctggagctggagcctgtggtggtatgtacacagctaacacaatggcttctgcaatcgaa
gccatgggaatgtcccttccttacagctcttcgataccagctgaagacccattgaaattg
gacgagtgccgtttagctggtaaatatcttttagaattgctaagaatggacttgaaacca
cgggatattatcactccacaatcccttcgtaatgcaatggttactgtcatggcccttgga
ggatcgacaaatgctgtattgcatctaattgctattgcaaggtctgttggtttggagttg
acccttgatgattttcagaaggtcagcgatgcggttccgtttctggcagatcttaaaccc
agtgggaaatatgttatggaggatatacataagattggtggcacaccagctgttcttcgc
tttctattagagcatggatttatggatggggattgtatgacagtcacagggcagactttg
gctcaaaatttagaaaacgtctccagcttaagtgaagggcaggagataattagacctgtg
tcaaatccaatcaaggagactggtcacatacaaattttgagaggagaccttgcaccagat
ggttctgtagcaaaaattaccggcaaagagggattatatttctcaggtcctgcgcttgta
tttgaaggagaggaatctatgcttgctgctatatcagcagacccaatgagttttaaggga
acagtggttgttatcagaggagaggggcctaaaggaggtccaggtatgcctgagatgttg
acaccaacaagtgcaataatgggtgccggtcttggaaaggaatgtgcattactgactgat
ggtaggttctctggtgggtcacacggttttgttgttggccacatctgccctgaagctcag
gagggtggtccgatcggtctggtagagaatggagacataatcaccattgacataggaaag
aagagaatagacacacaagtttcacccgaagaaatgaatgagcgtagaaagaaatggact
gctcctgcatacaaggttaaccgtggagtcctatacaagtacatcaagaacgttcaatcg
gcttcagatggatgtgtgactgatgagtaa

KEGG   Camelina sativa (false flax): 104789324
Entry
104789324         CDS       T05044                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic-like
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104789324
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104789324
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     104789324
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 104789324
NCBI-ProteinID: XP_010513347
LinkDB
Position
1:complement(12884395..12888130)
AA seq 609 aa
MQATIFSPRATLFPCKPLHPSHNVNSRNRPSTFSCSVQSVTADPSPPATDSNKLNKYSSR
ITEPKSQGGSQAILHGVGLSDDDLLKPQVGISSVWYEGNTCNMHLLKLSEAVKEGVENAG
MVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPG
TIMAMGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSC
PGAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLLELLKMDLKP
RDIITPQSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLSDFQKVSDAVPFLADLKP
SGKYVMEDIHKIGGTPAVLRFLLEHGFMDGDCMTVTGQTLAQNLENVPSLTEGQEIIRPV
SNPIKETGHIQILRGDLAPDGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMGFKG
TVVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQ
EGGPIGLVENGDIITIDIGKKRIDTQVSPEEMNERRKKWTAPAYKVNRGVLYKYIKNVQS
ASDGCVTDE
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgcaagccaccatcttctccccacgcgccactctcttcccctgtaaacctctccaccct
tcccacaatgtcaactctcgcaaccgcccctcaaccttctcctgctctgttcaatccgtg
accgctgatccttccccacccgccactgactccaacaagctcaacaagtacagctcgaga
atcactgaacccaaatcccaaggtgggtctcaagcgattcttcacggtgtgggtttatca
gacgacgatttgctgaaaccccaagttggtatctcgtcggtgtggtacgaagggaacact
tgtaatatgcatttgctgaagttgtctgaggctgtgaaagaaggagttgagaatgctggg
atggttgggtttaggtttaatacgattggtgttagtgatgctatctctatgggaacaaga
gggatgtgttttagtttgcagtctagggatttgattgctgatagtattgagactgtgatg
agtgctcagtggtatgatggcaacatttctattcctggttgtgataaaaatatgcctgga
actattatggctatgggaaggcttaacagaccaggcattatggtttatggtggaaccatt
aagcctggccattttcaagaaaagacgtatgacatagtatctgctttccagagttatgga
gaatttgttagtggttctataagtgatgaacagagaaagactgtcctccatcattcatgt
cctggagctggagcctgtggtggtatgtacacagctaacacaatggcttctgcaatcgaa
gccatgggaatgtcccttccttacagctcttcgataccagctgaagacccattaaaattg
gacgagtgccgtttagctggtaaatatcttttagaattgcttaagatggacttgaaacca
cgggacattatcactccacaatcacttcgtaatgcaatggttactgtcatggcccttggg
ggatctacaaatgctgtattgcatctaattgctattgcaaggtctgttggtttggagttg
acccttagtgattttcagaaggtcagcgatgcggttccatttctggcagatcttaaaccc
agtgggaaatatgttatggaggatatacataagattggtggcacaccagctgttcttcgc
tttttattagagcatggatttatggatggggattgtatgacagtcacagggcagactttg
gctcaaaatttagaaaacgtccccagcttaacagaagggcaggagataattagacctgtg
tcaaatccaatcaaggagactggacacatacaaatcttgagaggagaccttgcaccagat
ggttctgtagcaaaaattactggcaaagagggattatatttctctggtcctgcgcttgta
tttgaaggagaggaatctatgcttgctgctatatcagcagacccgatgggttttaaggga
acagttgttgttatcagaggagagggccctaaaggaggtccaggtatgcctgagatgttg
acaccaacaagtgcaataatgggtgccggtcttggaaaggaatgtgcattactgactgat
ggtaggttctctggtgggtcacatggttttgttgttggccacatctgccctgaagctcag
gagggtggtccgatcggtctggtagagaatggagacataatcaccattgacataggaaag
aagagaatagacacacaagtttcacccgaagaaatgaatgagcgtagaaagaaatggact
gctcctgcatacaaggttaaccgcggagttctatacaagtacatcaagaacgtgcaatcg
gcttcagatggatgtgtgactgatgagtaa

DBGET integrated database retrieval system