Camelina sativa (false flax): 104765199 Help Entry 104765199         CDS       T05044                                  Name (RefSeq) ubiquitin-like protein ATG12B   KO K08336   ubiquitin-like protein ATG12 Organism csat  Camelina sativa (false flax) Pathway csat04136   Autophagy - other Brite KEGG Orthology (KO) [BR:csat00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     104765199  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104765199    04121 Ubiquitin system [BR:csat04121]     104765199    03029 Mitochondrial biogenesis [BR:csat03029]     104765199 Membrane trafficking [BR:csat04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     104765199 Ubiquitin system [BR:csat04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    104765199 Mitochondrial biogenesis [BR:csat03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     104765199 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  104765199 NCBI-ProteinID:  XP_010487180 LinkDB All DBs Position 19:complement(6646762..6649939) Genome browser AA seq 94 aa AA seqDB search MATESPNSVQKIVVHLRATGGAPILKQSKFKISGTDKFAKVIDFLRRQLHSDSLFVYVNS AFSPNPDESVIDLYNNFGFDGKLVVNYASSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcgactgaatctccgaattctgtgcagaaaattgttgttcatctaagagctaccggt ggtgctccgatactgaaacaatctaaattcaagatttcagggactgataagtttgctaaa gtgattgactttctaagacggcagcttcactctgactcattgtttgtgtatgtaaacagc gctttctccccaaatcccgatgaatcggtaattgatctctataataactttgggtttgat ggtaaactggtggttaactatgccagttccatggcatggggttaa

DBGET integrated database retrieval system